Target Information

General Information of This Target
Target ID
BTDT00067
Target Name
Potassium voltage-gated channel subfamily A member 3 (KCNA3)
Target Bioclass
Transporter and channel
Uniprot ID
P22001
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
KCNA3
Gene ID
3738
Synonym
HGK5; HGK5; HLK3; HPCN3; Voltage-gated K(+) channel HuKIII; Voltage-gated potassium channel subunit Kv1.3
Sequence
MDERLSLLRSPPPPSARHRAHPPQRPASSGGAHTLVNHGYAEPAAGRELPPDMTVVPGDH
LLEPEVADGGGAPPQGGCGGGGCDRYEPLPPSLPAAGEQDCCGERVVINISGLRFETQLK
TLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDIF
SEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIVS
VLVILISIVIFCLETLPEFRDEKDYPASTSQDSFEAAGNSTSGSRAGASSFSDPFFVVET
LCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMSL
AILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAE
ADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVIV
SNFNYFYHRETEGEEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHS
AFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV

    Click to Show/Hide
Family
the potassium channel family
Function
Mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.

    Click to Show/Hide
Taxonomy ID
9606
TCDB ID
1.A.1.2.4
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Bgk (W5Y,F6A,Y26F) . . [1]
 Toxin Info    MgTX Dissociation constant
0.19 pM
 [2]
 Toxin Info    Potassium channel toxin alpha-KTx 23.1 Dissociation constant
2.9 pM
 [3], [4]
 Toxin Info    Potassium channel toxin alpha-KTx 23.2 Dissociation constant
2.9 pM
 [5]
 Toxin Info    Potassium channel toxin alpha-KTx 23.1 Dissociation constant
3 pM
 [4]
 Toxin Info    Potassium channel toxin alpha-KTx 2.2 Dissociation constant
0.011 nM
 [6]
 Toxin Info    Potassium channel toxin alpha-KTx 7.1 Dissociation constant
0.044 nM
 [7]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 Dissociation constant
0.1 nM
 [8]
 Toxin Info    Potassium channel toxin alpha-KTx 2.9 Dissociation constant
0.25 nM
 [9]
 Toxin Info    HgTX1 (A19C) Dissociation constant
0.28 nM
 [10]
 Toxin Info    Potassium channel toxin ShK (C3[Abu],C39[Abu]) Dissociation constant
0.462 nM
 [11]
 Toxin Info    Anuroctoxin (N17A,F32T) Dissociation constant
0.6 nM
 [12]
 Toxin Info    Potassium channel toxin alpha-KTx 2.8 Dissociation constant
0.7 nM
 [9]
 Toxin Info    Potassium channel toxin alpha-KTx 2.8 Dissociation constant
0.71 nM
 [9]
 Toxin Info    Potassium channel toxin alpha-KTx 6.12 Dissociation constant
0.73 nM
 [13]
 Toxin Info    Potassium channel toxin ShK (C3[Abu],C39[Abu]) Dissociation constant
0.762 nM
 [11]
 Toxin Info    Toxin VmKTx1 Dissociation constant
0.77 nM
 [14]
 Toxin Info    Toxin VmKTx1 Dissociation constant
0.77 nM
 [14], [15]
 Toxin Info    Potassium channel toxin alpha-KTx 7.2 Dissociation constant
0.795 nM
 [7]
 Toxin Info    Potassium channel toxin alpha-KTx 2.11 Dissociation constant
0.98 nM
 [9]
 Toxin Info    Invertebrate defensins family profile domain-containing protein Dissociation constant
1 nM
 [8]
 Toxin Info    Anuroctoxin (N17A) Dissociation constant
1.2 nM
 [12]
 Toxin Info    Potassium channel toxin alpha-KTx 32.1 Dissociation constant
1.3 nM
 [16]
 Toxin Info    IbTx (D4N,D6S,D24S) Dissociation constant
2.1 nM
 [17]
 Toxin Info    Potassium channel toxin ShK (C17[Abu],T32[Abu]) Dissociation constant
2.644 nM
 [11]
 Toxin Info    Anuroctoxin (F32T) Dissociation constant
6.2 nM
 [12]
 Toxin Info    Potassium channel toxin alpha-KTx 6.1 Dissociation constant
9.7 nM
 [18]
 Toxin Info    Kappa-actitoxin-Bgr1a Dissociation constant
10 nM
 [19]
 Toxin Info    Potassium channel toxin alpha-KTx 18.1 Dissociation constant
10 nM
 [20]
 Toxin Info    Potassium channel toxin alpha-KTx 4.6 Dissociation constant
10.7 nM
 [21]
 Toxin Info    Potassium channel toxin alpha-KTx 4.4 Dissociation constant
16 nM
 [20]
 Toxin Info    Potassium channel toxin alpha-KTx 6.17 Dissociation constant
17.7 nM
 [22], [23]
 Toxin Info    Potassium channel toxin alpha-KTx 6.17 Dissociation constant
18 nM
 [22]
 Toxin Info    Potassium channel toxin alpha-KTx 2.12 Dissociation constant
69 nM
 [9]
 Toxin Info    Potassium channel toxin alpha-KTx 24.1 Dissociation constant
77 nM
 [24]
 Toxin Info    Potassium channel toxin ShK (C12[Abu],C28[Abu]) Dissociation constant
94.8 nM
 [11]
 Toxin Info    PBTx1 Dissociation constant
100 nM
 [25]
 Toxin Info    IbTx_G30N Dissociation constant
220 nM
 [17]
 Toxin Info    Potassium channel toxin alpha-KTx 2.10 Dissociation constant
366 nM
 [9]
 Toxin Info    Potassium channel toxin alpha-KTx 1.10 Dissociation constant
492 nM
 [26]
 Toxin Info    Potassium channel toxin alpha-KTx 11.1 Dissociation constant
800 nM
 [25]
 Toxin Info    Potassium channel toxin kappa-KTx 1.2 Dissociation constant
40 μM
 [27- 31]
 Toxin Info    ChTx-c (E18Q,K19Y,Y21H,Y36F) Inhibition constant
0.027 nM
 [17]
 Toxin Info    ShK (R24Q) Inhibition constant
0.034 nM
 [32]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) Inhibition constant
0.198 nM
 [33]
 Toxin Info    Potassium channel toxin alpha-KTx 3.2 (K31G) Inhibition constant
0.69 nM
 [17]
 Toxin Info    Kappa-actitoxin-Bgr1a Inhibition constant
0.777 nM
 [1]
 Toxin Info    Potassium channel toxin ShK (K22N,Q24R) Inhibition constant
1.2 nM
 [32]
 Toxin Info    Bgk (W5Y,Y26F) Inhibition constant
1.809 nM
 [1]
 Toxin Info    Kappa-stichotoxin-Hmg1a Inhibition constant
3.1 nM
 [34]
 Toxin Info    IbTx (S8T,V9T,D19S,G30N) Inhibition constant
6.8 nM
 [17]
 Toxin Info    IbTx (D4N,D6S,G30N) Inhibition constant
9.9 nM
 [17]
 Toxin Info    IbTx (D24S,G30N) Inhibition constant
12.4 nM
 [17]
 Toxin Info    Bgk (W5Y,F6A,Y26F) Inhibition constant
134.4 nM
 [1]
 Toxin Info    Kappa-actitoxin-Aer3a Inhibition constant
1.23 μM
 [34]
 Toxin Info    Potassium channel toxin HmK Inhibition constant
2.225 μM
 [32]
 Toxin Info    Conotoxin vil14a Inhibition constant
12.1 μM
 [35], [36]
 Toxin Info    N.vectensis toxin 4 Effect . [37]
 Toxin Info    N.vectensis toxin 5 Effect . [37]
 Toxin Info    Potassium channel toxin ShK (D5[Nal]) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (D5E) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (D5K) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (D5R) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (F27E) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (F27R) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (I7[Nal]) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (K22[Nal]) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (K22E) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (K22R) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (M21E) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (R29[Nal]) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (S20[Nal]) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (S20E) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (S20R) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (T31R) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (Y23[Nal]) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (Y23E) Inhibition rate . [38]
 Toxin Info    Potassium channel toxin ShK (Y23R) Inhibition rate . [38]
 Toxin Info    Spinoxin (C34A) Inhibition rate . [39]
 Toxin Info    Spinoxin (S6A) Inhibition rate . [39]
 Toxin Info    Spinoxin (G18A) Inhibition rate . [39]
 Toxin Info    Spinoxin (I25A) Inhibition rate . [39]
 Toxin Info    Spinoxin (K15A) Inhibition rate . [40]
 Toxin Info    Spinoxin (K23A) Inhibition rate . [39]
 Toxin Info    Spinoxin (K27A) Inhibition rate . [39]
 Toxin Info    Spinoxin (N26A) Inhibition rate . [39]
 Toxin Info    Spinoxin (G5A) Inhibition rate . [39]
 Toxin Info    Spinoxin (S11A) Inhibition rate . [40]
 Toxin Info    Spinoxin (Y10A) Inhibition rate . [40]
 Toxin Info    Spinoxin (Y32A) Inhibition rate . [39]
 Toxin Info    Neurotoxin HsTX1 Inhibition rate . [41]
 Toxin Info    BeKm1 (R27K) Inhibition rate . [42]
 Toxin Info    VaTx2 Inhibition rate . [43]
 Toxin Info    U-actitoxin-Oulsp2 Inhibition rate . [44]
 Toxin Info    Mu-conotoxin CnIIIC Inhibition rate . [45], [46], [47]
 Toxin Info    Defensin-like protein 1 Inhibition rate . [48]
 Toxin Info    Jingzhaotoxin F7-15.33 Inhibition rate . [49]
 Toxin Info    Kappa-conotoxin RIIIK Inhibition rate . [50]
 Toxin Info    Potassium channel toxin alpha-KTx 13.2 Inhibition rate . [51]
 Toxin Info    Precursor protein UG Inhibition rate . [52]
 Toxin Info    Kunitz-type conkunitzin-S1 Inhibition rate . [53], [54], [55]
 Toxin Info    Kunitz-type serine protease inhibitor homolog dendrotoxin I Inhibition rate . [56]
 Toxin Info    Potassium channel toxin alpha-KTx 1.3 Inhibition rate . [17]
 Toxin Info    Potassium channel toxin alpha-KTx 15.2 Inhibition rate . [57]
 Toxin Info    Potassium channel toxin alpha-KTx 19.1 Inhibition rate . [58]
 Toxin Info    Potassium channel toxin alpha-KTx 4.8 Inhibition rate . [59]
 Toxin Info    Toxin PhcrTx2 Inhibition rate . [60]
 Toxin Info    U-Asilidin(12)-Dg3b Inhibition rate . [61], [62]
 Toxin Info    Potassium channel toxin alpha-KTx 2.17 Inhibition rate . [63]
 Toxin Info    Potassium channel toxin alpha-KTx 8.5 Inhibition rate . [64]
 Toxin Info    Potassium channel toxin kappa-KTx 2.5 Inhibition rate . [65]
 Toxin Info    U-actitoxin-Oulsp1 Inhibition rate . [66]
 Toxin Info    U-actitoxin-Oulsp1 Inhibition rate . [67]
 Toxin Info    Kappa-LhTx-1 Inhibition rate . [68]
 Toxin Info    Apamin Inhibition rate . [69- 86]
 Toxin Info    U-actitoxin-Avd3n Inhibition rate . [87]
 Toxin Info    Potassium channel toxin kappa-KTx 1.3 Inhibition rate . [30]
 Toxin Info    Potassium channel gamma toxin gamma-KTx 1.9 Inhibition rate . [63]
 Toxin Info    Kappa-theraphotoxin-Pg1a Inhibition rate . [88], [89], [90], [91]
 Toxin Info    KappaPI-actitoxin-Ael3a Inhibition rate . [92], [93]
 Toxin Info    BeKm1 Inhibition rate . [42]
 Toxin Info    BeKm1 Inhibition rate . [42]
 Toxin Info    BeKm1 Inhibition rate . [42]
 Toxin Info    ChTX (R19Y,Y36F,N30G) Inhibition rate . [17]
 Toxin Info    Spinoxin (D8A) Inhibition rate . [39]
 Toxin Info    Spinoxin (G33A) Inhibition rate . [39]
 Toxin Info    Kcug1 (C1K,T2C,A3T,S4A,K5S,Q6K,C7Q,W8C,P9W,V10P,C11V,N12C,Q13N,M14Q,F15M,G16F,K17G,P18K,N19P,G20N,K21G,C22K,M23C,N24M,G25N,K26G,C27K,R28C,C29R) Inhibition rate
1.4 %
 [94]
 Toxin Info    Beta/omega-theraphotoxin-Tp2a Inhibition rate
2 %
 [95- 114]
 Toxin Info    BmK86-P9 Inhibition rate
3.5 %
 [115]
 Toxin Info    BmK86-P8 Inhibition rate
3.7 %
 [115]
 Toxin Info    Kcug1 (C1T,T2D,A3V,S4K,K5C,Q6T,C7A,W8S,P9K,V10Q,N12W,Q13P,M14V,F15C,G16N,K17Q,P18M,N19F,C22P,M23N,N24G,G25K,K26C,C27M,R28N,C29G) Inhibition rate
3.8 %
 [94]
 Toxin Info    Kappa-hefutoxin 2 (Y2T,R3A,N4S,C5K,W6Q,R7C,E8W,G9P,N10V,D11C,E12N,E13Q,T14M,C15F,K16G,E17K,R18P,C19N) Inhibition rate
4.6 %
 [94]
 Toxin Info    CboK2 (D2N,K6R,R7K,R8K,N18G,A19R) Inhibition rate
9 %
 [116]
 Toxin Info    Defensin BmKDfsin5 Inhibition rate
9 %
 [117]
 Toxin Info    Peptide TsPep3 Inhibition rate
10 %
 [118], [119], [120]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.2 Inhibition rate
10 %
 [119], [118], [121], [120]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.2 Inhibition rate
10 %
 [121]
 Toxin Info    Kunitz-type serine protease inhibitor HCRG21 Inhibition rate
14 %
 [122]
 Toxin Info    Beta-defensin 3 Inhibition rate
15 %
 [123]
 Toxin Info    4 kDa defensin (R21A) Inhibition rate
16 %
 [124]
 Toxin Info    Kappa-HfTx2 (C1A,T2C,A3Y,S4R,K5N,Q6C,C7W,W8R,P9E,V10G,C11N,N12D,Q13E,M14E,F15T,G16C,P18E,N19R,G20C) Inhibition rate
17.3 %
 [28]
 Toxin Info    4 kDa defensin (R20A) Inhibition rate
19 %
 [124]
 Toxin Info    Potassium channel toxin AbeTx1 Inhibition rate
20 %
 [125]
 Toxin Info    Pi-stichotoxin-Hcr5b Inhibition rate
20 %
 [126]
 Toxin Info    Potassium channel toxin alpha-KTx 16.4 Inhibition rate
20 %
 [127]
 Toxin Info    Potassium channel toxin kappa-KTx 2.9 Inhibition rate
22 %
 [24]
 Toxin Info    Potassium channel toxin kappa-KTx 2.2 Inhibition rate
24 %
 [128]
 Toxin Info    Kunitz-type proteinase inhibitor AEPI-II Inhibition rate
25.3 %
 [28]
 Toxin Info    Defensin domain protein Inhibition rate
26 %
 [129]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.1 Inhibition rate
27 %
 [118- 130]
 Toxin Info    4 kDa defensin Inhibition rate
29 %
 [124]
 Toxin Info    Beta-defensin 104 Inhibition rate
34 %
 [131]
 Toxin Info    4 kDa defensin (A21R,R37A) Inhibition rate
34 %
 [124]
 Toxin Info    Potassium channel toxin kappa-KTx 2.2 Inhibition rate
36 %
 [128]
 Toxin Info    Plant antimicrobial peptide domain-containing protein_K6Y_Q7R_R18K_R19K Inhibition rate
39 %
 [132]
 Toxin Info    Invertebrate defensins family profile domain-containing protein Inhibition rate
39 %
 [133]
 Toxin Info    Beta/omega-theraphotoxin-Tp1a Inhibition rate
40 %
 [95- 137]
 Toxin Info    4 kDa defensin (R37A) Inhibition rate
43 %
 [124]
 Toxin Info    BmK86-P1 Inhibition rate
52 %
 [115]
 Toxin Info    Plant antimicrobial peptide domain-containing protein_K6Y_Q7R Inhibition rate
59 %
 [132]
 Toxin Info    Plant antimicrobial peptide domain-containing protein Inhibition rate
62 %
 [132]
 Toxin Info    Potassium channel toxin kappa-KTx 2.3 Inhibition rate
70 %
 [128]
 Toxin Info    Potassium channel toxin alpha-KTx 31.1 Inhibition rate
83 %
 [138]
 Toxin Info    Potassium channel toxin alpha-KTx 31.1 Inhibition rate
83 %
 [138]
 Toxin Info    Potassium channel toxin alpha-KTx 19.2 Inhibition rate
100 %
 [139]
 Toxin Info    Potassium channel toxin alpha-KTx 3.6 Inhibition rate
100 %
 [140]
 Toxin Info    Potassium channel toxin alpha-KTx 23.2 Inhibition rate
100 %
 [5]
 Toxin Info    Potassium channel toxin alpha-KTx 20.1 Effective concentration 50
7.9 nM
 [141]
 Toxin Info    Potassium channel toxin alpha-KTx 3.13 IC50
171 pM
 [140]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) IC50
0.012 nM
 [38]
 Toxin Info    Defensin beta 4A IC50
0.022 nM
 [142]
 Toxin Info    Potassium channel toxin ShK (K30R) IC50
0.038 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (A14[Nal]) IC50
0.039 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T31A) IC50
0.039 nM
 [38]
 Toxin Info    (M21[Nle])ShK IC50
0.04 nM
 [38]
 Toxin Info    Tozuleristide (G24R,R25F,Y29M) IC50
0.06 nM
 [143]
 Toxin Info    Potassium channel toxin ShK (G33E) IC50
0.06 nM
 [38]
 Toxin Info    ShK (Q16K)-Ala IC50
0.06 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R24A) IC50
0.062 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K18A) IC50
0.06384 nM
 [144]
 Toxin Info    Potassium channel toxin ShK (R24K) IC50
0.067 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T34E) IC50
0.067 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R29A) IC50
0.07 nM
 [38]
 Toxin Info    (M21[Nle]-(Lys16)ShK-Ala IC50
0.071 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (A14K) IC50
0.073 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (F15[Nal]) IC50
0.073 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S10R) IC50
0.073 nM
 [38]
 Toxin Info    ShK (S2R) IC50
0.074 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (G33A) IC50
0.075 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (I4E) IC50
0.075 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T34[Nal]) IC50
0.077 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (A14R) IC50
0.079 nM
 [38]
 Toxin Info    ShK (P8A) IC50
0.079 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (Q16[Dab]) IC50
0.082 nM
 [38]
 Toxin Info    ShK (P8K) IC50
0.083 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (F15A) IC50
0.085 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (F15R) IC50
0.088 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (H19R) IC50
0.095 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S2E) IC50
0.095 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K9R) IC50
0.096 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (P8E) IC50
0.097 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (L25K) IC50
0.1 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) IC50
0.102 nM
 [145]
 Toxin Info    Potassium channel toxin ShK (L25[Nal]) IC50
0.103 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K18R) IC50
0.104 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (F15W) IC50
0.1064 nM
 [144]
 Toxin Info    (M21[Nle])ShK IC50
0.1064 nM
 [144]
 Toxin Info    Potassium channel toxin ShK (L25R) IC50
0.107 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (A14E) IC50
0.11 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (I4R) IC50
0.11 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) IC50
0.11 nM
 [33]
 Toxin Info    Potassium channel toxin ShK (F15A) IC50
0.11305 nM
 [144]
 Toxin Info    Potassium channel toxin ShK (L25A) IC50
0.115 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K9A) IC50
0.119 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K18E) IC50
0.12 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (G33K) IC50
0.122 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S26K) IC50
0.122 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R1S) IC50
0.12236 nM
 [144]
 Toxin Info    Potassium channel toxin ShK (T31[Nal]) IC50
0.126 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T6K) IC50
0.129 nM
 [38]
 Toxin Info    (M21[Nle]-(Lys16)ShK-amide IC50
0.13 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R11K) IC50
0.133 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S10E) IC50
0.133 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T34A) IC50
0.133 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S26A) IC50
0.135 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (Q16[Orn]) IC50
0.14 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R29E) IC50
0.143 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K9E) IC50
0.146 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S2K) IC50
0.146 nM
 [38]
 Toxin Info    HD5 (20-94) IC50
0.151 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T13E) IC50
0.152 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T13R) IC50
0.152 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (I4K) IC50
0.153 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T34K) IC50
0.153 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T6[Nal]) IC50
0.153 nM
 [38]
 Toxin Info    (M21[Nle]-(Lys16)ShK IC50
0.153 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (I4[Nal]) IC50
0.154 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R1K) IC50
0.154 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T13K) IC50
0.154 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S2A) IC50
0.156 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T13A) IC50
0.156 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S10A) IC50
0.159 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K22[Orn]) IC50
0.1596 nM
 [144]
 Toxin Info    Potassium channel toxin ShK (K30[Nal]) IC50
0.161 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K18A) IC50
0.163 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (Q16R) IC50
0.166 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R1A) IC50
0.166 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T6E) IC50
0.171 nM
 [38]
 Toxin Info    Potassium channel toxin alpha-KTx 3.13 IC50
0.171 nM
 [140]
 Toxin Info    Potassium channel toxin ShK (Y23F) IC50
0.1729 nM
 [144]
 Toxin Info    Potassium channel toxin ShK (K30A) IC50
0.173 nM
 [38]
 Toxin Info    ShK (Q16K) IC50
0.174 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (I4A) IC50
0.179 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T6R) IC50
0.179 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (G33[Nal]) IC50
0.182 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S10K) IC50
0.184 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (H19K) IC50
0.19 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T34R) IC50
0.191 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S20K) IC50
0.193 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S20A) IC50
0.195 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (Q16A) IC50
0.196 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (Q16E) IC50
0.197 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (I7A) IC50
0.201 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S26[Nal]) IC50
0.207 nM
 [38]
 Toxin Info    ShK (Q16K)-amide IC50
0.207 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S10[Nal]) IC50
0.216 nM
 [38]
 Toxin Info    Potassium channel toxin ShK ([pTyr],[AEEA]) IC50
0.221 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (G33R) IC50
0.221 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (F27[Nal]) IC50
0.223 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R1[Nal]) IC50
0.223 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T6A) IC50
0.226 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (M21A) IC50
0.227 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T31E) IC50
0.234 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (T13[Nal]) IC50
0.235 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (H19A) IC50
0.24 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (L25E) IC50
0.245 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S2[Nal]) IC50
0.257 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (M21R) IC50
0.259 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R24E) IC50
0.26 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (Y23A) IC50
0.261 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (H19E) IC50
0.265 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (F15E) IC50
0.267 nM
 [38]
 Toxin Info    ShK (F27A) IC50
0.275 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K30E) IC50
0.278 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (S26R) IC50
0.278 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (H19[Nal]) IC50
0.28 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R29K) IC50
0.293 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (F15K) IC50
0.294 nM
 [38]
 Toxin Info    ([20kDa-PEG])-ShK IC50
0.299 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (I7R) IC50
0.303 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K22A) IC50
0.3059 nM
 [144]
 Toxin Info    Potassium channel toxin ShK (R24A) IC50
0.3192 nM
 [144]
 Toxin Info    Potassium channel toxin ShK (S26E) IC50
0.32 nM
 [38]
 Toxin Info    ShK (Q16K)-amide IC50
0.352 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R11A) IC50
0.431 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (P8R) IC50
0.447 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K22A) IC50
0.456 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K9[Nal]) IC50
0.472 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K18[Nal]) IC50
0.475 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (I7K) IC50
0.561 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K22[Nle]) IC50
0.663 nM
 [145]
 Toxin Info    Potassium channel toxin ShK (M21K) IC50
0.798 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (M21[Nal]) IC50
0.853 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R11[Nal]) IC50
0.927 nM
 [38]
 Toxin Info    ([20kDa-PEG] -(Lys16)-ShK IC50
0.94 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (R11E) IC50
0.983 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (F27K) IC50
0.985 nM
 [38]
 Toxin Info    Potassium channel toxin ShK ([30kDa-PEG]) IC50
1.2 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (K9Q) IC50
1.27 nM
 [144]
 Toxin Info    Potassium channel toxin ShK (I7E) IC50
1.308 nM
 [38]
 Toxin Info    Toxin MeKTx11-3 IC50
1.4 nM
 [146]
 Toxin Info    Potassium channel toxin ShK (T31K) IC50
1.417 nM
 [38]
 Toxin Info    Potassium channel toxin ShK (Q16[Nal]) IC50
1.444 nM
 [38]
 Toxin Info    Potassium channel toxin ShK ([20kDa-brPEG]) IC50
2.1 nM
 [38]
 Toxin Info    Potassium channel toxin alpha-KTx 8.6 IC50
2.36 nM
 [147]
 Toxin Info    Potassium channel toxin ShK (K22[Nle]) IC50
3.059 nM
 [144]
 Toxin Info    ChTx-b IC50
4.1 nM
 [148]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) IC50
4.5 nM
 [33]
 Toxin Info    Potassium channel toxin ShK (R11Q) IC50
5.586 nM
 [144]
 Toxin Info    Potassium channel toxin alpha-KTx 3.7 IC50
6 nM
 [149]
 Toxin Info    Potassium channel toxin alpha-KTx 3.11 IC50
7.2 nM
 [150]
 Toxin Info    Potassium channel toxin alpha-KTx 2.13 IC50
7.2 nM
 [151]
 Toxin Info    His6-GFP-L2-AgTx2 IC50
8 nM
 [149]
 Toxin Info    MeuKTx (G11R,G30R,D33H) IC50
8.1 nM
 [152- 171]
 Toxin Info    Potassium channel toxin alpha-KTx 2.15 IC50
8.3 nM
 [63]
 Toxin Info    Potassium channel toxin alpha-KTx 2.15 IC50
8.3 nM
 [63]
 Toxin Info    Potassium channel toxin alpha-KTx 3.19 IC50
8.9 nM
 [172]
 Toxin Info    Potassium channel toxin alpha-KTx 3.2 IC50
9 nM
 [149]
 Toxin Info    Toxin MeKTx13-3 (Q12A,K15A,K18A,D33R) IC50
9.1 nM
 [172]
 Toxin Info    Kappa-actitoxin-Bcs3b IC50
13.12 nM
 [173]
 Toxin Info    Kappa-actitoxin-Bcs3b IC50
13.12 nM
 [173]
 Toxin Info    Toxin MeKTx11-3 (P37S) IC50
13.6 nM
 [146]
 Toxin Info    Defensin BmKDfsin3 IC50
23.4 nM
 [117- 174]
 Toxin Info    Potassium channel toxin alpha-KTx 2.16 IC50
26.2 nM
 [63]
 Toxin Info    Potassium channel toxin alpha-KTx 2.16 IC50
26.2 nM
 [63]
 Toxin Info    PI-stichotoxin-Hcr2g IC50
29.7 nM
 [122]
 Toxin Info    PI-stichotoxin-Hcr2g IC50
29.7 nM
 [122- 176]
 Toxin Info    Potassium channel toxin ShK (K22R) IC50
29.925 nM
 [144]
 Toxin Info    PI-stichotoxin-Hcr2f IC50
40.7 nM
 [122]
 Toxin Info    PI-stichotoxin-Hcr2f IC50
40.7 nM
 [122- 176]
 Toxin Info    Uro (K25A,T19Q,A25K) IC50
67 nM
 [177]
 Toxin Info    Potassium channel toxin alpha-KTx 1.16 IC50
67 nM
 [146- 178]
 Toxin Info    Potassium channel toxin alpha-KTx 1.16 IC50
67 nM
 [146]
 Toxin Info    Potassium channel toxin alpha-KTx 6.13 IC50
69 nM
 [39]
 Toxin Info    Potassium channel toxin alpha-KTx 10.4 IC50
72 nM
 [63]
 Toxin Info    Potassium channel toxin alpha-KTx 10.4 IC50
72 nM
 [63]
 Toxin Info    Kappa-actitoxin-Bcs3a IC50
74 nM
 [173]
 Toxin Info    Kappa-actitoxin-Bcs3a IC50
74.11 nM
 [173]
 Toxin Info    Potassium channel toxin alpha-KTx 1.17 IC50
78 nM
 [146]
 Toxin Info    Potassium channel toxin alpha-KTx 1.17 IC50
78 nM
 [146- 178]
 Toxin Info    Potassium channel toxin alpha-KTx 6.21 IC50
91 nM
 [179]
 Toxin Info    Potassium channel toxin alpha-KTx 6.21 IC50
91 nM
 [179], [177]
 Toxin Info    Neutrophil defensin 1 IC50
102 nM
 [180]
 Toxin Info    Potassium channel toxin alpha-KTx 16.7 IC50
118 nM
 [181]
 Toxin Info    Potassium channel toxin alpha-KTx 8.2 IC50
133 nM
 [147]
 Toxin Info    Beta-defensin 103 IC50
187.6 nM
 [131]
 Toxin Info    Defensin domain protein IC50
200 nM
 [129]
 Toxin Info    Potassium channel toxin alpha-KTx 1.15 IC50
215.3 nM
 [94]
 Toxin Info    Spinoxin (C13A,C31A) IC50
227 nM
 [39]
 Toxin Info    Spinoxin (P12A) IC50
251 nM
 [39]
 Toxin Info    ShKT domain-containing protein IC50
266 nM
 [182], [183]
 Toxin Info    Potassium channel toxin alpha-KTx 8.2 IC50
269 - 467 nM
 [147- 188]
 Toxin Info    Spinoxin (P20A) IC50
276 nM
 [39]
 Toxin Info    Crotamine IC50
287 nM
 [189]
 Toxin Info    Potassium channel toxin alpha-KTx 3.18 IC50
311.7 nM
 [152- 171]
 Toxin Info    Spinoxin (M14A) IC50
452 nM
 [39]
 Toxin Info    Spinoxin (I1A) IC50
484 nM
 [39]
 Toxin Info    Potassium channel toxin alpha-KTx 8.8 IC50
503 nM
 [190]
 Toxin Info    Potassium channel toxin alpha-KTx 8.8 IC50
503 nM
 [190]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 IC50
508 nM
 [191]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 IC50
508 nM
 [118- 193]
 Toxin Info    Defensin BmKDfsin4 IC50
510 nM
 [124]
 Toxin Info    Spinoxin (N21A) IC50
519 nM
 [40]
 Toxin Info    Neurotoxin beta-KTx 14.3 IC50
542 nM
 [39]
 Toxin Info    Potassium channel toxin alpha-KTx 3.10 IC50
550 nM
 [194]
 Toxin Info    Spinoxin (T17A) IC50
668 nM
 [39]
 Toxin Info    Kappa-actitoxin-Bcs4a IC50
1.00648 μM
 [195]
 Toxin Info    Kappa-actitoxin-Bcs4a IC50
1.00668 μM
 [195]
 Toxin Info    Spinoxin (Y33A) IC50
1.01 μM
 [39]
 Toxin Info    Kcug1 (C1V,T2K,A3C,S4T,K5A,Q6S,C7K,W8Q,P9C,V10W,C11P,N12V,Q13C,M14N,F15Q,G16M,K17F,P18G,N19K,G20P,K21N,C22G,M23K,N24C,G25M,K26N,C27G,R28K) IC50
1.1424 μM
 [94]
 Toxin Info    Spinoxin (S4A) IC50
1.262 μM
 [40]
 Toxin Info    Spinoxin (K30A) IC50
1.995 μM
 [39]
 Toxin Info    Spinoxin (Q16A) IC50
2.163 μM
 [39]
 Toxin Info    Defensin alpha 5 IC50
2.2 μM
 [180]
 Toxin Info    Fungal defensin plectasin IC50
2.8 μM
 [196]
 Toxin Info    Spinoxin (R7A) IC50
2.87 μM
 [39]
 Toxin Info    Uro (K25A,A25K) IC50
2.99 μM
 [177]
 Toxin Info    Kappa-actitoxin-Ate1a IC50
3.051 μM
 [197]
 Toxin Info    Metalloendopeptidase IC50
6.9 μM
 [182- 198]
 Toxin Info    Kappa-conotoxin RIIIJ IC50
10 μM
 [50]
 Toxin Info    Beta-defensin 1 IC50
11.8 μM
 [199]
 Toxin Info    Spinoxin (S28A) IC50
12.7 μM
 [39]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.1 IC50
17.1 μM
 [121]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.1 IC50
17.1 μM
 [118- 130]
 Toxin Info    Conorfamide-Sr3 IC50
24 μM
 [200]
 Toxin Info    Conorfamide-Sr3 IC50
24 μM
 [201], [200]
 Toxin Info    Spinoxin (K30A) IC50
26.769 μM
 [39]
 Toxin Info    Kappa-hefutoxin 3 IC50
53.7 μM
 [30]
 Toxin Info    Kappa-hefutoxin 3 (K20E) IC50
115.7 μM
 [30]
 Toxin Info    Uro (K25A) IC50
294.2 μM
 [177]
References
Ref 1 Characterization of a novel radiolabeled peptide selective for a subpopulation of voltage-gated potassium channels in mammalian brain. J Biol Chem. 2002 Feb 8;277(6):3886-93. doi: 10.1074/jbc.M109886200. Epub 2001 Nov 13.
Ref 2 Margatoxin binds to a homomultimer of K(V)1.3 channels in Jurkat cells. Comparison with K(V)1.3 expressed in CHO cells. Biochemistry. 1997 Mar 25;36(12):3737-44. doi: 10.1021/bi962351p.
Ref 3 Structure, function, and chemical synthesis of Vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes. Biochemistry. 2012 May 15;51(19):4049-61. doi: 10.1021/bi300060n. Epub 2012 May 7.
Ref 4 Vm24, a natural immunosuppressive peptide, potently and selectively blocks Kv1.3 potassium channels of human T cells. Mol Pharmacol. 2012 Sep;82(3):372-82. doi: 10.1124/mol.112.078006. Epub 2012 May 23.
Ref 5 Vm23 and vm24, two scorpion peptides that block human t-lymphocyte potassium channels (sub-type kv1.3) with high selectivity and decrease the in vivo dth-responses in rats.
Ref 6 Margatoxin is a non-selective inhibitor of human Kv1.3 K+ channels. Toxicon. 2014 Sep;87:6-16. doi: 10.1016/j.toxicon.2014.05.002. Epub 2014 May 28.
Ref 7 Effects of toxins Pi2 and Pi3 on human T lymphocyte Kv1.3 channels: the role of Glu7 and Lys24. J Membr Biol. 2001 Jan 1;179(1):13-25. doi: 10.1007/s002320010033.
Ref 8 A designer ligand specific for Kv1.3 channels from a scorpion neurotoxin-based library. Proc Natl Acad Sci U S A. 2009 Dec 29;106(52):22211-6. doi: 10.1073/pnas.0910123106. Epub 2009 Dec 10.
Ref 9 Novel alpha-KTx peptides from the venom of the scorpion Centruroides elegans selectively blockade Kv1.3 over IKCa1 K+ channels of T cells. Toxicon. 2005 Sep 15;46(4):418-29. doi: 10.1016/j.toxicon.2005.06.001.
Ref 10 Ultrasensitive pharmacological characterisation of the voltage-gated potassium channel K(V)1.3 studied by single-molecule fluorescence microscopy. Histochem Cell Biol. 2002 Mar;117(3):197-202. doi: 10.1007/s00418-001-0374-y. Epub 2002 Jan 30.
Ref 11 Role of disulfide bonds in the structure and potassium channel blocking activity of ShK toxin. Biochemistry. 1999 Nov 2;38(44):14549-58. doi: 10.1021/bi991282m.
Ref 12 An engineered scorpion toxin analogue with improved Kv1.3 selectivity displays reduced conformational flexibility. Sci Rep. 2015 Dec 22;5:18397. doi: 10.1038/srep18397.
Ref 13 Anuroctoxin, a new scorpion toxin of the alpha-KTx 6 subfamily, is highly selective for Kv1.3 over IKCa1 ion channels of human T lymphocytes. Mol Pharmacol. 2005 Apr;67(4):1034-44. doi: 10.1124/mol.104.007187. Epub 2004 Dec 22.
Ref 14 sVmKTx, a transcriptome analysis-based synthetic peptide analogue of Vm24, inhibits Kv1.3 channels of human T cells with improved selectivity. Biochem Pharmacol. 2022 May;199:115023. doi: 10.1016/j.bcp.2022.115023. Epub 2022 Mar 28.
Ref 15 Transcriptome analysis of scorpion species belonging to the Vaejovis genus. PLoS One. 2015 Feb 6;10(2):e0117188. doi: 10.1371/journal.pone.0117188. eCollection 2015.
Ref 16 Cm28, a scorpion toxin having a unique primary structure, inhibits KV1.2 and KV1.3 with high affinity. J Gen Physiol. 2022 Aug 1;154(8):e202213146. doi: 10.1085/jgp.202213146. Epub 2022 Jun 14.
Ref 17 Revealing the molecular determinants of neurotoxin specificity for calcium-activated versus voltage-dependent potassium channels. Biochemistry. 2007 May 8;46(18):5358-64. doi: 10.1021/bi700150t. Epub 2007 Apr 18.
Ref 18 Pandinus imperator scorpion venom blocks voltage-gated K+ channels in human lymphocytes. Biochem Biophys Res Commun. 1998 Jan 26;242(3):621-5. doi: 10.1006/bbrc.1997.8018.
Ref 19 A potassium-channel toxin from the sea anemone Bunodosoma granulifera, an inhibitor for Kv1 channels. Revision of the amino acid sequence, disulfide-bridge assignment, chemical synthesis, and biological activity. Eur J Biochem. 1997 Feb 15;244(1):192-202. doi: 10.1111/j.1432-1033.1997.00192.x.
Ref 20 Two novel toxins from the Amazonian scorpion Tityus cambridgei that block Kv1.3 and Shaker B K(+)-channels with distinctly different affinities. Biochim Biophys Acta. 2002 Dec 16;1601(2):123-31. doi: 10.1016/s1570-9639(02)00458-2.
Ref 21 Tst26, a novel peptide blocker of Kv1.2 and Kv1.3 channels from the venom of Tityus stigmurus. Toxicon. 2009 Sep 15;54(4):379-89. doi: 10.1016/j.toxicon.2009.05.023. Epub 2009 Jun 3.
Ref 22 OcyKTx2, a new K?-channel toxin characterized from the venom of the scorpion Opisthacanthus cayaporum. Peptides. 2013 Aug;46:40-6. doi: 10.1016/j.peptides.2013.04.021. Epub 2013 May 15.
Ref 23 Mass spectrometry analysis, amino acid sequence and biological activity of venom components from the Brazilian scorpion Opisthacanthus cayaporum. Toxicon. 2008 Jun 15;51(8):1499-508. doi: 10.1016/j.toxicon.2008.03.029. Epub 2008 Apr 4.
Ref 24 Pi5 and Pi6, two undescribed peptides from the venom of the scorpion Pandinus imperator and their effects on K(+)-channels. Toxicon. 2017 Jul;133:136-144. doi: 10.1016/j.toxicon.2017.05.011. Epub 2017 May 11.
Ref 25 A subfamily of acidic alpha-K(+) toxins. J Biol Chem. 2004 Jan 23;279(4):2781-9. doi: 10.1074/jbc.M311029200. Epub 2003 Oct 14.
Ref 26 Purification, characterization and biosynthesis of parabutoxin 3, a component of Parabuthus transvaalicus venom. Eur J Biochem. 2002 Apr;269(7):1854-65. doi: 10.1046/j.1432-1033.2002.02833.x.
Ref 27 kappa-Hefutoxin1, a novel toxin from the scorpion Heterometrus fulvipes with unique structure and function. Importance of the functional diad in potassium channel selectivity. J Biol Chem. 2002 Aug 16;277(33):30040-7. doi: 10.1074/jbc.M111258200. Epub 2002 May 28.
Ref 28 Synthesis and characterization of amino acid deletion analogs of -hefutoxin 1, a scorpion toxin on potassium channels. Toxicon. 2013 Sep;71:25-30. doi: 10.1016/j.toxicon.2013.05.010. Epub 2013 May 29.
Ref 29 Expanding the pharmacological profile of -hefutoxin 1 and analogues: A focus on the inhibitory effect on the oncogenic channel K(v)10.1. Peptides. 2017 Dec;98:43-50. doi: 10.1016/j.peptides.2016.08.008. Epub 2016 Aug 28.
Ref 30 Assignment of voltage-gated potassium channel blocking activity to kappa-KTx1.3, a non-toxic homologue of kappa-hefutoxin-1, from Heterometrus spinifer venom. Biochem Pharmacol. 2005 Feb 15;69(4):669-78. doi: 10.1016/j.bcp.2004.10.018. Epub 2004 Dec 29.
Ref 31 Screening, large-scale production and structure-based classification of cystine-dense peptides. Nat Struct Mol Biol. 2018 Mar;25(3):270-278. doi: 10.1038/s41594-018-0033-9. Epub 2018 Feb 26.
Ref 32 Tethered peptide neurotoxins display two blocking mechanisms in the K(+) channel pore as do their untethered analogs. Sci Adv. 2020 Mar 4;6(10):eaaz3439. doi: 10.1126/sciadv.aaz3439. eCollection 2020 Mar.
Ref 33 Substitution of a single residue in Stichodactyla helianthus peptide, ShK-Dap22, reveals a novel pharmacological profile. Biochemistry. 2003 Nov 25;42(46):13698-707. doi: 10.1021/bi035209e.
Ref 34 Designer and natural peptide toxin blockers of the KcsA potassium channel identified by phage display. Proc Natl Acad Sci U S A. 2015 Dec 15;112(50):E7013-21. doi: 10.1073/pnas.1514728112. Epub 2015 Dec 1.
Ref 35 Definition of the R-superfamily of conotoxins: Structural convergence of helix-loop-helix peptidic scaffolds. Peptides. 2018 Sep;107:75-82. doi: 10.1016/j.peptides.2018.06.002. Epub 2018 Jul 21.
Ref 36 A novel conotoxin framework with a helix-loop-helix (Cs alpha/alpha) fold. Biochemistry. 2005 Dec 13;44(49):15986-96. doi: 10.1021/bi0511181.
Ref 37 The Birth and Death of Toxins with Distinct Functions: A Case Study in the Sea Anemone Nematostella. Mol Biol Evol. 2019 Sep 1;36(9):2001-2012. doi: 10.1093/molbev/msz132.
Ref 38 Pharmaceutical Optimization of Peptide Toxins for Ion Channel Targets: Potent, Selective, and Long-Lived Antagonists of Kv1.3. J Med Chem. 2015 Sep 10;58(17):6784-802. doi: 10.1021/acs.jmedchem.5b00495. Epub 2015 Aug 31.
Ref 39 Active Sites of Spinoxin, a Potassium Channel Scorpion Toxin, Elucidated by Systematic Alanine Scanning. Biochemistry. 2016 May 31;55(21):2927-35. doi: 10.1021/acs.biochem.6b00139. Epub 2016 May 18.
Ref 40 Role of individual disulfide bridges in the conformation and activity of spinoxin (-KTx6.13), a potassium channel toxin from Heterometrus spinifer scorpion venom. Toxicon. 2016 Nov;122:31-38. doi: 10.1016/j.toxicon.2016.09.013. Epub 2016 Sep 19.
Ref 41 A Fluorescent Peptide Toxin for Selective Visualization of the Voltage-Gated Potassium Channel K(V)1.3. Bioconjug Chem. 2022 Nov 16;33(11):2197-2212. doi: 10.1021/acs.bioconjchem.2c00436. Epub 2022 Nov 4.
Ref 42 Fluorescent analogues of BeKm-1 with high and specific activity against the hERG channel. Toxicon X. 2019 Feb 23;2:100010. doi: 10.1016/j.toxcx.2019.100010. eCollection 2019 Apr.
Ref 43 Experimental conversion of a defensin into a neurotoxin: implications for origin of toxic function. Mol Biol Evol. 2014 Mar;31(3):546-59. doi: 10.1093/molbev/msu038. Epub 2014 Jan 14.
Ref 44 Synthesis, folding, structure and activity of a predicted peptide from the sea anemone Oulactis sp. with an ShKT fold. Toxicon. 2018 Aug;150:50-59. doi: 10.1016/j.toxicon.2018.05.006. Epub 2018 May 19.
Ref 45 A novel -conopeptide, CnIIIC, exerts potent and preferential inhibition of NaV1.2/1.4 channels and blocks neuronal nicotinic acetylcholine receptors. Br J Pharmacol. 2012 Jul;166(5):1654-68. doi: 10.1111/j.1476-5381.2012.01837.x.
Ref 46 Large-scale discovery of conopeptides and conoproteins in the injectable venom of a fish-hunting cone snail using a combined proteomic and transcriptomic approach. J Proteomics. 2012 Sep 18;75(17):5215-25. doi: 10.1016/j.jprot.2012.06.001. Epub 2012 Jun 13.
Ref 47 Peptide therapeutics from venom: Current status and potential. Bioorg Med Chem. 2018 Jun 1;26(10):2738-2758. doi: 10.1016/j.bmc.2017.09.029. Epub 2017 Sep 23.
Ref 48 The antifungal plant defensin AtPDF2.3 from Arabidopsis thaliana blocks potassium channels. Sci Rep. 2016 Aug 30;6:32121. doi: 10.1038/srep32121.
Ref 49 Jingzhaotoxin-X, a gating modifier of Kv4.2 and Kv4.3 potassium channels purified from the venom of the Chinese tarantula Chilobrachys jingzhao. J Venom Anim Toxins Incl Trop Dis. 2020 May 29;26:e20190043. doi: 10.1590/1678-9199-JVATITD-2019-0043.
Ref 50 Biochemical characterization of kappaM-RIIIJ, a Kv1.2 channel blocker: evaluation of cardioprotective effects of kappaM-conotoxins. J Biol Chem. 2010 May 14;285(20):14882-14889. doi: 10.1074/jbc.M109.068486. Epub 2010 Mar 10.
Ref 51 OsK2, a new selective inhibitor of Kv1.2 potassium channels purified from the venom of the scorpion Orthochirus scrobiculosus. Biochem Biophys Res Commun. 2001 Sep 7;286(5):841-7. doi: 10.1006/bbrc.2001.5492.
Ref 52 Sea anemone peptide with uncommon -hairpin structure inhibits acid-sensing ion channel 3 (ASIC3) and reveals analgesic activity. J Biol Chem. 2013 Aug 9;288(32):23116-27. doi: 10.1074/jbc.M113.485516. Epub 2013 Jun 25.
Ref 53 Production of recombinant Conkunitzin-S1 in Escherichia coli. Protein Expr Purif. 2006 Jun;47(2):640-4. doi: 10.1016/j.pep.2006.01.019. Epub 2006 Feb 20.
Ref 54 Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family. Structural and functional characterization. J Biol Chem. 2005 Jun 24;280(25):23766-70. doi: 10.1074/jbc.C500064200. Epub 2005 Apr 15.
Ref 55 Structure of conkunitzin-S1, a neurotoxin and Kunitz-fold disulfide variant from cone snail. Acta Crystallogr D Biol Crystallogr. 2006 Sep;62(Pt 9):980-90. doi: 10.1107/S0907444906021123. Epub 2006 Aug 19.
Ref 56 A rapidly activating and slowly inactivating potassium channel cloned from human heart. Functional analysis after stable mammalian cell culture expression. J Gen Physiol. 1993 Apr;101(4):513-43. doi: 10.1085/jgp.101.4.513.
Ref 57 BmTx3, a scorpion toxin with two putative functional faces separately active on A-type K+ and HERG currents. Biochem J. 2004 Mar 15;378(Pt 3):745-52. doi: 10.1042/BJ20031324.
Ref 58 BmBKTx1, a novel Ca2+-activated K+ channel blocker purified from the Asian scorpion Buthus martensi Karsch. J Biol Chem. 2004 Aug 13;279(33):34562-9. doi: 10.1074/jbc.M312798200. Epub 2004 Jun 3.
Ref 59 Characterization and Chemical Synthesis of Cm39 (-KTx 4.8): A Scorpion Toxin That Inhibits Voltage-Gated K(+) Channel K(V)1.2 and Small- and Intermediate-Conductance Ca(2+)-Activated K(+) Channels K(Ca)2.2 and K(Ca)3.1. Toxins (Basel). 2023 Jan 5;15(1):41. doi: 10.3390/toxins15010041.
Ref 60 PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer. Toxins (Basel). 2018 Feb 7;10(2):72. doi: 10.3390/toxins10020072.
Ref 61 Buzz Kill: Function and Proteomic Composition of Venom from the Giant Assassin Fly Dolopus genitalis (Diptera: Asilidae). Toxins (Basel). 2018 Nov 5;10(11):456. doi: 10.3390/toxins10110456.
Ref 62 Weaponisation 'on the fly': Convergent recruitment of knottin and defensin peptide scaffolds into the venom of predatory assassin flies. Insect Biochem Mol Biol. 2020 Mar;118:103310. doi: 10.1016/j.ibmb.2019.103310. Epub 2019 Dec 21.
Ref 63 Isolation, chemical and functional characterization of several new K(+)-channel blocking peptides from the venom of the scorpion Centruroides tecomanus. Toxicon. 2016 Jun 1;115:1-12. doi: 10.1016/j.toxicon.2016.02.017. Epub 2016 Feb 26.
Ref 64 The first potassium channel toxin from the venom of the Iranian scorpion Odonthobuthus doriae. FEBS Lett. 2006 Nov 13;580(26):6254-8. doi: 10.1016/j.febslet.2006.10.029. Epub 2006 Oct 20.
Ref 65 The new kappa-KTx 2.5 from the scorpion Opisthacanthus cayaporum. Peptides. 2011 Jul;32(7):1509-17. doi: 10.1016/j.peptides.2011.05.017. Epub 2011 May 23.
Ref 66 Sunanda, Punnepalli, et al. "Identification, chemical synthesis, structure, and function of a new KV1 channel blocking peptide from Oulactis sp." Peptide Science 110.4 (2018): e24073.
Ref 67 Structure, folding and stability of a minimal homologue from Anemonia sulcata of the sea anemone potassium channel blocker ShK. Peptides. 2018 Jan;99:169-178. doi: 10.1016/j.peptides.2017.10.001. Epub 2017 Oct 6.
Ref 68 Variation of Two S3b Residues in K(V)4.1-4.3 Channels Underlies Their Different Modulations by Spider Toxin -LhTx-1. Front Pharmacol. 2021 Jun 10;12:692076. doi: 10.3389/fphar.2021.692076. eCollection 2021.
Ref 69 The precursors of the bee venom constituents apamin and MCD peptide are encoded by two genes in tandem which share the same 3'-exon. J Biol Chem. 1995 May 26;270(21):12704-8. doi: 10.1074/jbc.270.21.12704.
Ref 70 The peptide components of bee venom. Eur J Biochem. 1976 Jan 15;61(2):369-76. doi: 10.1111/j.1432-1033.1976.tb10030.x.
Ref 71 Apamin as a selective blocker of the calcium-dependent potassium channel in neuroblastoma cells: voltage-clamp and biochemical characterization of the toxin receptor. Proc Natl Acad Sci U S A. 1982 Feb;79(4):1308-12. doi: 10.1073/pnas.79.4.1308.
Ref 72 Apamin, a blocker of the calcium-activated potassium channel, induces neurodegeneration of Purkinje cells exclusively. Brain Res. 1997 Dec 19;778(2):405-8. doi: 10.1016/s0006-8993(97)01165-7.
Ref 73 Determinants of apamin and d-tubocurarine block in SK potassium channels. J Biol Chem. 1997 Sep 12;272(37):23195-200. doi: 10.1074/jbc.272.37.23195.
Ref 74 Pharmacological characterization of small-conductance Ca(2+)-activated K(+) channels stably expressed in HEK 293 cells. Br J Pharmacol. 2000 Mar;129(5):991-9. doi: 10.1038/sj.bjp.0703120.
Ref 75 SK3 is an important component of K(+) channels mediating the afterhyperpolarization in cultured rat SCG neurones. J Physiol. 2001 Sep 1;535(Pt 2):323-34. doi: 10.1111/j.1469-7793.2001.00323.x.
Ref 76 Apamin interacts with all subtypes of cloned small-conductance Ca2+-activated K+ channels. Pflugers Arch. 2001 Jan;441(4):544-50. doi: 10.1007/s004240000447.
Ref 77 An amino acid outside the pore region influences apamin sensitivity in small conductance Ca2+-activated K+ channels. J Biol Chem. 2007 Feb 9;282(6):3478-86. doi: 10.1074/jbc.M607213200. Epub 2006 Dec 1.
Ref 78 Apamin reduces neuromuscular transmission by activating inhibitory muscarinic M(2) receptors on motor nerve terminals. Eur J Pharmacol. 2010 Jan 25;626(2-3):239-43. doi: 10.1016/j.ejphar.2009.09.064. Epub 2009 Oct 8.
Ref 79 Allosteric block of KCa2 channels by apamin. J Biol Chem. 2010 Aug 27;285(35):27067-27077. doi: 10.1074/jbc.M110.110072. Epub 2010 Jun 18.
Ref 80 The small neurotoxin apamin blocks not only small conductance Ca(2+) activated K(+) channels (SK type) but also the voltage dependent Kv1.3 channel. Eur Biophys J. 2017 Sep;46(6):517-523. doi: 10.1007/s00249-016-1196-0. Epub 2017 Jan 20.
Ref 81 Apamin inhibits TNF-- and IFN--induced inflammatory cytokines and chemokines via suppressions of NF-B signaling pathway and STAT in human keratinocytes. Pharmacol Rep. 2017 Oct;69(5):1030-1035. doi: 10.1016/j.pharep.2017.04.006. Epub 2017 Apr 18.
Ref 82 Apamin Suppresses LPS-Induced Neuroinflammatory Responses by Regulating SK Channels and TLR4-Mediated Signaling Pathways. Int J Mol Sci. 2020 Jun 17;21(12):4319. doi: 10.3390/ijms21124319.
Ref 83 Apamin from bee venom suppresses inflammation in a murine model of gouty arthritis. J Ethnopharmacol. 2020 Jul 15;257:112860. doi: 10.1016/j.jep.2020.112860. Epub 2020 Apr 11.
Ref 84 Antioxidative, Antiapoptotic, and Anti-Inflammatory Effects of Apamin in a Murine Model of Lipopolysaccharide-Induced Acute Kidney Injury. Molecules. 2020 Dec 3;25(23):5717. doi: 10.3390/molecules25235717.
Ref 85 Solution structure of apamin determined by nuclear magnetic resonance and distance geometry. Biochemistry. 1988 Nov 1;27(22):8491-8. doi: 10.1021/bi00422a029.
Ref 86 Binding and toxicity of apamin. Characterization of the active site. Eur J Biochem. 1991 Mar 28;196(3):639-45. doi: 10.1111/j.1432-1033.1991.tb15860.x.
Ref 87 AsKC11, a Kunitz Peptide from Anemonia sulcata, Is a Novel Activator of G Protein-Coupled Inward-Rectifier Potassium Channels. Mar Drugs. 2022 Feb 15;20(2):140. doi: 10.3390/md20020140.
Ref 88 Blockers of the delayed-rectifier potassium current in pancreatic beta-cells enhance glucose-dependent insulin secretion. Diabetes. 2006 Apr;55(4):1034-42. doi: 10.2337/diabetes.55.04.06.db05-0788.
Ref 89 Gating modifier peptides as probes of pancreatic beta-cell physiology. Toxicon. 2007 Feb;49(2):231-8. doi: 10.1016/j.toxicon.2006.09.012. Epub 2006 Sep 23.
Ref 90 A KV2.1 gating modifier binding assay suitable for high throughput screening. Channels (Austin). 2009 Nov;3(6):437-47. doi: 10.4161/chan.3.6.10201.
Ref 91 Solution structure of GxTX-1E, a high-affinity tarantula toxin interacting with voltage sensors in Kv2.1 potassium channels. Biochemistry. 2010 Jun 29;49(25):5134-42. doi: 10.1021/bi100246u.
Ref 92 A bifunctional sea anemone peptide with Kunitz type protease and potassium channel inhibiting properties. Biochem Pharmacol. 2011 Jul 1;82(1):81-90. doi: 10.1016/j.bcp.2011.03.023. Epub 2011 Apr 6.
Ref 93 Development of a rational nomenclature for naming peptide and protein toxins from sea anemones. Toxicon. 2012 Sep 15;60(4):539-50. doi: 10.1016/j.toxicon.2012.05.020. Epub 2012 Jun 5.
Ref 94 Different pharmacological properties between scorpion toxin BmKcug2 and its degraded analogs highlight the diversity of K(+) channel blockers from thermally processed scorpions. Int J Biol Macromol. 2021 May 1;178:143-153. doi: 10.1016/j.ijbiomac.2021.02.155. Epub 2021 Feb 23.
Ref 95 Two tarantula peptides inhibit activation of multiple sodium channels. Biochemistry. 2002 Dec 17;41(50):14734-47. doi: 10.1021/bi026546a.
Ref 96 Differential phospholipid binding by site 3 and site 4 toxins. Implications for structural variability between voltage-sensitive sodium channel domains. J Biol Chem. 2005 Mar 25;280(12):11127-33. doi: 10.1074/jbc.M412552200. Epub 2005 Jan 4.
Ref 97 Molecular interactions of the gating modifier toxin ProTx-II with NaV 1.5: implied existence of a novel toxin binding site coupled to activation. J Biol Chem. 2007 Apr 27;282(17):12687-97. doi: 10.1074/jbc.M610462200. Epub 2007 Mar 5.
Ref 98 ProTx-I and ProTx-II: gating modifiers of voltage-gated sodium channels. Toxicon. 2007 Feb;49(2):194-201. doi: 10.1016/j.toxicon.2006.09.014. Epub 2006 Sep 27.
Ref 99 Inhibition of sodium channel gating by trapping the domain II voltage sensor with protoxin II. Mol Pharmacol. 2008 Mar;73(3):1020-8. doi: 10.1124/mol.107.041046. Epub 2007 Dec 21.
Ref 100 ProTx-II, a selective inhibitor of NaV1.7 sodium channels, blocks action potential propagation in nociceptors. Mol Pharmacol. 2008 Nov;74(5):1476-84. doi: 10.1124/mol.108.047670. Epub 2008 Aug 26.
Ref 101 Evidence for multiple effects of ProTxII on activation gating in Na(V)1.5. Toxicon. 2008 Sep 1;52(3):489-500. doi: 10.1016/j.toxicon.2008.06.023. Epub 2008 Jul 9.
Ref 102 The tarantula toxins ProTx-II and huwentoxin-IV differentially interact with human Nav1.7 voltage sensors to inhibit channel activation and inactivation. Mol Pharmacol. 2010 Dec;78(6):1124-34. doi: 10.1124/mol.110.066332. Epub 2010 Sep 20.
Ref 103 Inhibition of the activation pathway of the T-type calcium channel Ca(V)3.1 by ProTxII. Toxicon. 2010 Sep 15;56(4):624-36. doi: 10.1016/j.toxicon.2010.06.009. Epub 2010 Jun 23.
Ref 104 Crystallographic insights into sodium-channel modulation by the 4 subunit. Proc Natl Acad Sci U S A. 2013 Dec 17;110(51):E5016-24. doi: 10.1073/pnas.1314557110. Epub 2013 Dec 2.
Ref 105 Block of T-type calcium channels by protoxins I and II. Mol Brain. 2014 May 9;7:36. doi: 10.1186/1756-6606-7-36.
Ref 106 High Proteolytic Resistance of Spider-Derived Inhibitor Cystine Knots. Int J Pept. 2015;2015:537508. doi: 10.1155/2015/537508. Epub 2015 Dec 30.
Ref 107 Engineering potent and selective analogues of GpTx-1, a tarantula venom peptide antagonist of the Na(V)1.7 sodium channel. J Med Chem. 2015 Mar 12;58(5):2299-314. doi: 10.1021/jm501765v. Epub 2015 Feb 19.
Ref 108 Binary architecture of the Nav1.2-2 signaling complex. Elife. 2016 Feb 19;5:e10960. doi: 10.7554/eLife.10960.
Ref 109 Insensitivity to pain induced by a potent selective closed-state Nav1.7 inhibitor. Sci Rep. 2017 Jan 3;7:39662. doi: 10.1038/srep39662.
Ref 110 Chemical Synthesis, Proper Folding, Na(v) Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. doi: 10.3390/toxins11060367.
Ref 111 Studies examining the relationship between the chemical structure of protoxin II and its activity on voltage gated sodium channels. J Med Chem. 2014 Aug 14;57(15):6623-31. doi: 10.1021/jm500687u. Epub 2014 Jul 24.
Ref 112 Interaction of Tarantula Venom Peptide ProTx-II with Lipid Membranes Is a Prerequisite for Its Inhibition of Human Voltage-gated Sodium Channel NaV1.7. J Biol Chem. 2016 Aug 12;291(33):17049-65. doi: 10.1074/jbc.M116.729095. Epub 2016 Jun 16.
Ref 113 Structural Basis of Nav1.7 Inhibition by a Gating-Modifier Spider Toxin. Cell. 2019 Feb 7;176(4):702-715.e14. doi: 10.1016/j.cell.2018.12.018. Epub 2019 Jan 17.
Ref 114 Structures of human Na(v)1.7 channel in complex with auxiliary subunits and animal toxins. Science. 2019 Mar 22;363(6433):1303-1308. doi: 10.1126/science.aaw2493. Epub 2019 Feb 14.
Ref 115 BmK86-P1, a New Degradation Peptide with Desirable Thermostability and Kv1.2 Channel-Specific Activity from Traditional Chinese Scorpion Medicinal Material. Toxins (Basel). 2021 Aug 30;13(9):610. doi: 10.3390/toxins13090610.
Ref 116 ImKTx96, a peptide blocker of the Kv1.2 ion channel from the venom of the scorpion Isometrus maculates. Peptides. 2020 Jan;123:170172. doi: 10.1016/j.peptides.2019.170172. Epub 2019 Oct 15.
Ref 117 Ion channel modulation by scorpion hemolymph and its defensin ingredients highlights origin of neurotoxins in telson formed in Paleozoic scorpions. Int J Biol Macromol. 2020 Apr 1;148:351-363. doi: 10.1016/j.ijbiomac.2020.01.133. Epub 2020 Jan 15.
Ref 118 Novel components of Tityus serrulatus venom: A transcriptomic approach. Toxicon. 2021 Jan 15;189:91-104. doi: 10.1016/j.toxicon.2020.11.001. Epub 2020 Nov 10.
Ref 119 Novel structural class of four disulfide-bridged peptides from Tityus serrulatus venom. Biochem Biophys Res Commun. 2003 Feb 21;301(4):1086-92. doi: 10.1016/s0006-291x(03)00082-2.
Ref 120 Tityus serrulatus scorpion venom and toxins: an overview. Protein Pept Lett. 2009;16(8):920-32. doi: 10.2174/092986609788923329.
Ref 121 Structural and Functional Elucidation of Peptide Ts11 Shows Evidence of a Novel Subfamily of Scorpion Venom Toxins. Toxins (Basel). 2016 Sep 30;8(10):288. doi: 10.3390/toxins8100288.
Ref 122 Kunitz-Type Peptides from the Sea Anemone Heteractis crispa Demonstrate Potassium Channel Blocking and Anti-Inflammatory Activities. Biomedicines. 2020 Nov 4;8(11):473. doi: 10.3390/biomedicines8110473.
Ref 123 Mouse -Defensin 3, A Defensin Inhibitor of Both Its Endogenous and Exogenous Potassium Channels. Molecules. 2018 Jun 20;23(6):1489. doi: 10.3390/molecules23061489.
Ref 124 Scorpion Potassium Channel-blocking Defensin Highlights a Functional Link with Neurotoxin. J Biol Chem. 2016 Mar 25;291(13):7097-106. doi: 10.1074/jbc.M115.680611. Epub 2016 Jan 27.
Ref 125 AbeTx1 Is a Novel Sea Anemone Toxin with a Dual Mechanism of Action on Shaker-Type K? Channels Activation. Mar Drugs. 2018 Oct 1;16(10):360. doi: 10.3390/md16100360.
Ref 126 A Tale of Toxin Promiscuity: The Versatile Pharmacological Effects of Hcr 1b-2 Sea Anemone Peptide on Voltage-Gated Ion Channels. Mar Drugs. 2022 Feb 17;20(2):147. doi: 10.3390/md20020147.
Ref 127 Molecular divergence of two orthologous scorpion toxins affecting potassium channels. Comp Biochem Physiol A Mol Integr Physiol. 2011 Jul;159(3):313-21. doi: 10.1016/j.cbpa.2011.03.027. Epub 2011 Apr 3.
Ref 128 An unusual fold for potassium channel blockers: NMR structure of three toxins from the scorpion Opisthacanthus madagascariensis. Biochem J. 2005 May 15;388(Pt 1):263-71. doi: 10.1042/BJ20041705.
Ref 129 Genome and Transcriptome Sequences Reveal the Specific Parasitism of the Nematophagous Purpureocillium lilacinum 36-1. Front Microbiol. 2016 Jul 19;7:1084. doi: 10.3389/fmicb.2016.01084. eCollection 2016.
Ref 130 Proteomic endorsed transcriptomic profiles of venom glands from Tityus obscurus and T. serrulatus scorpions. PLoS One. 2018 Mar 21;13(3):e0193739. doi: 10.1371/journal.pone.0193739. eCollection 2018.
Ref 131 Pharmacological characterization of human beta-defensins 3 and 4 on potassium channels: Evidence of diversity in beta-defensin-potassium channel interactions. Peptides. 2018 Oct;108:14-18. doi: 10.1016/j.peptides.2018.08.005. Epub 2018 Aug 16.
Ref 132 Potassium channel blocker crafted by -hairpinin scaffold engineering. Biophys J. 2021 Jun 15;120(12):2471-2481. doi: 10.1016/j.bpj.2021.04.020. Epub 2021 Apr 29.
Ref 133 The Dynamic Genome and Transcriptome of the Human Fungal Pathogen Blastomyces and Close Relative Emmonsia. PLoS Genet. 2015 Oct 6;11(10):e1005493. doi: 10.1371/journal.pgen.1005493. eCollection 2015 Oct.
Ref 134 Tarantula toxin ProTx-I differentiates between human T-type voltage-gated Ca2+ Channels Cav3.1 and Cav3.2. J Pharmacol Sci. 2010;112(4):452-8. doi: 10.1254/jphs.09356fp. Epub 2010 Mar 30.
Ref 135 Gating modifier toxins isolated from spider venom: Modulation of voltage-gated sodium channels and the role of lipid membranes. J Biol Chem. 2018 Jun 8;293(23):9041-9052. doi: 10.1074/jbc.RA118.002553. Epub 2018 Apr 27.
Ref 136 Mutational analysis of ProTx-I and the novel venom peptide Pe1b provide insight into residues responsible for selective inhibition of the analgesic drug target Na(V)1.7. Biochem Pharmacol. 2020 Nov;181:114080. doi: 10.1016/j.bcp.2020.114080. Epub 2020 Jun 6.
Ref 137 A tarantula-venom peptide antagonizes the TRPA1 nociceptor ion channel by binding to the S1-S4 gating domain. Curr Biol. 2014 Mar 3;24(5):473-83. doi: 10.1016/j.cub.2014.01.013. Epub 2014 Feb 13.
Ref 138 Kbot55, purified from Buthus occitanus tunetanus venom, represents the first member of a novel -KTx subfamily. Peptides. 2016 Jun;80:4-8. doi: 10.1016/j.peptides.2015.05.015. Epub 2015 Jun 14.
Ref 139 Characterization of Kbot21 Reveals Novel Side Chain Interactions of Scorpion Toxins Inhibiting Voltage-Gated Potassium Channels. PLoS One. 2015 Sep 23;10(9):e0137611. doi: 10.1371/journal.pone.0137611. eCollection 2015.
Ref 140 A potent potassium channel blocker from Mesobuthus eupeus scorpion venom. Biochimie. 2010 Dec;92(12):1847-53. doi: 10.1016/j.biochi.2010.08.003. Epub 2010 Aug 14.
Ref 141 A novel toxin from the venom of the scorpion Tityus trivittatus, is the first member of a new alpha-KTX subfamily. FEBS Lett. 2006 Jan 23;580(2):592-6. doi: 10.1016/j.febslet.2005.12.073. Epub 2006 Jan 4.
Ref 142 Endogenous animal toxin-like human -defensin 2 inhibits own K(+) channels through interaction with channel extracellular pore region. Cell Mol Life Sci. 2015 Feb;72(4):845-53. doi: 10.1007/s00018-014-1715-z. Epub 2014 Sep 20.
Ref 143 Structure-function study of a chlorotoxin-chimer and its activity on Kv1.3 channels. J Chromatogr B Analyt Technol Biomed Life Sci. 2004 Apr 15;803(1):67-73. doi: 10.1016/j.jchromb.2003.11.029.
Ref 144 Identification of three separate binding sites on SHK toxin, a potent inhibitor of voltage-dependent potassium channels in human T-lymphocytes and rat brain. Biochem Biophys Res Commun. 1996 Feb 27;219(3):696-701. doi: 10.1006/bbrc.1996.0297.
Ref 145 ShK-Dap22, a potent Kv1.3-specific immunosuppressive polypeptide. J Biol Chem. 1998 Dec 4;273(49):32697-707. doi: 10.1074/jbc.273.49.32697.
Ref 146 K(V)1.2 channel-specific blocker from Mesobuthus eupeus scorpion venom: Structural basis of selectivity. Neuropharmacology. 2018 Dec;143:228-238. doi: 10.1016/j.neuropharm.2018.09.030. Epub 2018 Sep 22.
Ref 147 Molecular diversity and functional evolution of scorpion potassium channel toxins. Mol Cell Proteomics. 2011 Feb;10(2):M110.002832. doi: 10.1074/mcp.M110.002832. Epub 2010 Sep 30.
Ref 148 Gigolaev, A. M., et al. "KV1. 2-Selective Peptide with High Affinity."?Journal of Evolutionary Biochemistry and Physiology?58.6 (2022): 2048-2057.
Ref 149 Fluorescent protein-scorpion toxin chimera is a convenient molecular tool for studies of potassium channels. Sci Rep. 2016 Sep 21;6:33314. doi: 10.1038/srep33314.
Ref 150 OdK2, a Kv1.3 channel-selective toxin from the venom of the Iranian scorpion Odonthobuthus doriae. Toxicon. 2008 Jun 15;51(8):1424-30. doi: 10.1016/j.toxicon.2008.03.027. Epub 2008 Mar 29.
Ref 151 A selective blocker of Kv1.2 and Kv1.3 potassium channels from the venom of the scorpion Centruroides suffusus suffusus. Biochem Pharmacol. 2008 Oct 30;76(9):1142-54. doi: 10.1016/j.bcp.2008.08.018. Epub 2008 Aug 22.
Ref 152 Retraction: Role of mesenchymal stem cells versus angiotensin converting enzyme inhibitor in kidney repair. Nephrology (Carlton). 2024 Apr;29(4):239. doi: 10.1111/nep.14278. Epub 2024 Feb 11.
Ref 153 Photogeneration and quenching of singlet molecular oxygen by bacterial C(40) carotenoids with long chain of conjugated double bonds. Photosynth Res. 2024 Mar;159(2-3):291-301. doi: 10.1007/s11120-023-01070-6. Epub 2024 Feb 5.
Ref 154 Density Functional Theory, Molecular Dynamics and AlteQ Studies Approaches of Baimantuoluoamide A and Baimantuoluoamide B to Identify Potential Inhibitors of M(pro) Proteins: a Novel Target for the Treatment of SARS COVID-19. JETP Lett. 2023 May 15:1-10. doi: 10.1134/S0021364023600039. Online ahead of print.
Ref 155 Melatonin Confers NaCl Tolerance in Withaniacoagulans L. by Maintaining Na(+)/K(+) Homeostasis, Strengthening the Antioxidant Defense System and Modulating Withanolides Synthesis-Related Genes. Russ J Plant Physiol. 2023;70(3):52. doi: 10.1134/S1021443723600125. Epub 2023 May 23.
Ref 156 Rhodococcus rhodochrous IEGM 1360, an Effective Biocatalyst of C3 Oxidative Transformation of Oleanane Triterpenoids. Microbiology (N Y). 2023;92(2):204-214. doi: 10.1134/S0026261722603360. Epub 2023 Apr 21.
Ref 157 Quaternary Ammonium Salt Strategy and Molecular Docking Studies of Novel 5-Acyl-8-(Arylamino)-Quinolines by Acetyl and Methanesulfonyl Chloride for Dual Evaluation Bioactivity. Russ J Bioorg Chem. 2023;49(2):367-375. doi: 10.1134/S1068162023020097. Epub 2023 Feb 21.
Ref 158 Erratum to: Prospects for the Use of Marine Sulfated Fucose-Rich Polysaccharides in Treatment and Prevention of COVID-19 and Post-COVID-19 Syndrome. Russ J Bioorg Chem. 2022;48(6):1372. doi: 10.1134/S1068162022340015. Epub 2022 Dec 23.
Ref 159 Current Trends and Approaches to the Search for Genetic Determinants of Aging and Longevity. Russ J Genet. 2022;58(12):1427-1443. doi: 10.1134/S1022795422120067. Epub 2022 Dec 28.
Ref 160 Design, Synthesis, Anti-Tubercular Evaluation and Teratogenicity Studies of Furanyl Pyrazolo[3,4-b] Quinoline-5-Ones. Russ J Bioorg Chem. 2023;49(1):127-138. doi: 10.1134/S1068162023010053. Epub 2022 Dec 22.
Ref 161 Rapid Assessment of Neutralizing Antibodies Using Influenza Viruses with a Luciferase Reporter. Appl Biochem Microbiol. 2022;58(7):878-886. doi: 10.1134/S0003683822070067. Epub 2022 Dec 6.
Ref 162 Analysis of adiabatic trapping phenomena for quasi-integrable area-preserving maps in the presence of time-dependent exciters. Phys Rev E. 2022 Sep;106(3-1):034204. doi: 10.1103/PhysRevE.106.034204.
Ref 163 Synthesis, Antiviral, and Antibacterial Activity of the Glycyrrhizic Acid and Glycyrrhetinic Acid Derivatives. Russ J Bioorg Chem. 2022;48(5):906-918. doi: 10.1134/S1068162022050132. Epub 2022 Jul 28.
Ref 164 Erratum to: Evaluation of the Effects of Favipiravir Combined with Vitamin C on Alveolar Bone in Rats. J Evol Biochem Physiol. 2022;58(3):941. doi: 10.1134/S0022093022030280. Epub 2022 Jun 29.
Ref 165 Design, Synthesis, and Molecular Docking Studies of Some New Quinoxaline Derivatives as EGFR Targeting Agents. Russ J Bioorg Chem. 2022;48(3):565-575. doi: 10.1134/S1068162022030220. Epub 2022 Jun 21.
Ref 166 Identification of Some Promising Heterocycles Useful in Treatment of Allergic Rhinitis: Virtual Screening, Pharmacophore Mapping, Molecular Docking, and Molecular Dynamics. Russ J Bioorg Chem. 2022;48(2):438-456. doi: 10.1134/S1068162022330019. Epub 2022 May 26.
Ref 167 Erratum to: Experimental Search for New Means of Pathogenetic Therapy COVID-19: Inhibitor of H2-Receptors Famotidine Increases the Effect of Oseltamivir on Survival and Immune Status of Mice Infected by A/PR/8/34 (H1N1). J Evol Biochem Physiol. 2022;58(2):623. doi: 10.1134/S0022093022020284. Epub 2022 May 16.
Ref 168 MicroRNAs as the Potential Regulators of SARS-CoV-2 Infection and Modifiers of the COVID-19 Clinical Features. Mol Biol. 2022;56(1):29-45. doi: 10.1134/S0026893322010034. Epub 2022 Feb 12.
Ref 169 Predators as Control Agents of Mosquito Larvae in Micro-Reservoirs (Review). Inland Water Biol. 2022;15(1):39-53. doi: 10.1134/S1995082922010138. Epub 2022 Mar 12.
Ref 170 Molecular Beacon DNA Probes with Fluorescein Bifluorophore. Russ J Bioorg Chem. 2021;47(3):734-740. doi: 10.1134/S1068162021030055. Epub 2021 Jun 11.
Ref 171 Synthesis, Molecular Docking, In Silico ADME Predictions, and Toxicity Studies of N-Substituted-5-(4-Chloroquinolin-2-yl)-1,3,4-Thiadiazol-2-Amine Derivatives as COVID-19 Inhibitors. Russ J Bioorg Chem. 2021;47(1):158-165. doi: 10.1134/S1068162021010155. Epub 2021 Mar 20.
Ref 172 Tuning Scorpion Toxin Selectivity: Switching From K(V)1.1 to K(V)1.3. Front Pharmacol. 2020 Jul 7;11:1010. doi: 10.3389/fphar.2020.01010. eCollection 2020.
Ref 173 Biochemical and electrophysiological characterization of two sea anemone type 1 potassium toxins from a geographically distant population of Bunodosoma caissarum. Mar Drugs. 2013 Mar 6;11(3):655-79. doi: 10.3390/md11030655.
Ref 174 The genome of Mesobuthus martensii reveals a unique adaptation model of arthropods. Nat Commun. 2013;4:2602. doi: 10.1038/ncomms3602.
Ref 175 New Kunitz-Type HCRG Polypeptides from the Sea Anemone Heteractis crispa. Mar Drugs. 2015 Sep 24;13(10):6038-63. doi: 10.3390/md13106038.
Ref 176 Sea Anemone Kunitz-Type Peptides Demonstrate Neuroprotective Activity in the 6-Hydroxydopamine Induced Neurotoxicity Model. Biomedicines. 2021 Mar 10;9(3):283. doi: 10.3390/biomedicines9030283.
Ref 177 Structural basis of the potency and selectivity of Urotoxin, a potent Kv1 blocker from scorpion venom. Biochem Pharmacol. 2020 Apr;174:113782. doi: 10.1016/j.bcp.2019.113782. Epub 2019 Dec 25.
Ref 178 Variability of Potassium Channel Blockers in Mesobuthus eupeus Scorpion Venom with Focus on Kv1.1: AN INTEGRATED TRANSCRIPTOMIC AND PROTEOMIC STUDY. J Biol Chem. 2015 May 8;290(19):12195-209. doi: 10.1074/jbc.M115.637611. Epub 2015 Mar 19.
Ref 179 Structure, molecular modeling, and function of the novel potassium channel blocker urotoxin isolated from the venom of the Australian scorpion Urodacus yaschenkoi. Mol Pharmacol. 2014 Jul;86(1):28-41. doi: 10.1124/mol.113.090183. Epub 2014 Apr 10.
Ref 180 Human -defensins are immune-related Kv1.3 channel inhibitors: new support for their roles in adaptive immunity. FASEB J. 2015 Oct;29(10):4324-33. doi: 10.1096/fj.15-274787. Epub 2015 Jul 6.
Ref 181 Novel potassium channel blocker venom peptides from Mesobuthus gibbosus (Scorpiones: Buthidae). Toxicon. 2013 Jan;61:72-82. doi: 10.1016/j.toxicon.2012.10.010. Epub 2012 Nov 7.
Ref 182 Kv1.3 channel-blocking immunomodulatory peptides from parasitic worms: implications for autoimmune diseases. FASEB J. 2014 Sep;28(9):3952-64. doi: 10.1096/fj.14-251967. Epub 2014 Jun 2.
Ref 183 The genome and transcriptome of the zoonotic hookworm Ancylostoma ceylanicum identify infection-specific gene families. Nat Genet. 2015 Apr;47(4):416-22. doi: 10.1038/ng.3237. Epub 2015 Mar 2.
Ref 184 Genomic organization of three neurotoxins active on small conductance Ca2+-activated potassium channels from the scorpion Buthus martensi Karsch. FEBS Lett. 1999 Jun 11;452(3):360-4. doi: 10.1016/s0014-5793(99)00651-1.
Ref 185 Scorpion Toxin, BmP01, Induces Pain by Targeting TRPV1 Channel. Toxins (Basel). 2015 Sep 14;7(9):3671-87. doi: 10.3390/toxins7093671.
Ref 186 Characterization of four toxins from Buthus martensi scorpion venom, which act on apamin-sensitive Ca2+-activated K+ channels. Eur J Biochem. 1997 Apr 15;245(2):457-64. doi: 10.1111/j.1432-1033.1997.00457.x.
Ref 187 Solution structure of BmP01 from the venom of scorpion Buthus martensii Karsch. Biochem Biophys Res Commun. 2000 Oct 5;276(3):1148-54. doi: 10.1006/bbrc.2000.3435.
Ref 188 Structural and functional diversity of acidic scorpion potassium channel toxins. PLoS One. 2012;7(4):e35154. doi: 10.1371/journal.pone.0035154. Epub 2012 Apr 12.
Ref 189 Crotamine pharmacology revisited: novel insights based on the inhibition of KV channels. Mol Pharmacol. 2012 Jul;82(1):90-6. doi: 10.1124/mol.112.078188. Epub 2012 Apr 12.
Ref 190 C-Terminal residues in small potassium channel blockers OdK1 and OSK3 from scorpion venom fine-tune the selectivity. Biochim Biophys Acta Proteins Proteom. 2017 May;1865(5):465-472. doi: 10.1016/j.bbapap.2017.02.001. Epub 2017 Feb 4.
Ref 191 Purification and characterization of Ts15, the first member of a new -KTX subfamily from the venom of the Brazilian scorpion Tityus serrulatus. Toxicon. 2011 Jul;58(1):54-61. doi: 10.1016/j.toxicon.2011.05.001. Epub 2011 May 13.
Ref 192 Moving pieces in a venomic puzzle: unveiling post-translationally modified toxins from Tityus serrulatus. J Proteome Res. 2013 Jul 5;12(7):3460-70. doi: 10.1021/pr4003068. Epub 2013 Jun 13.
Ref 193 Influence of post-starvation extraction time and prey-specific diet in Tityus serrulatus scorpion venom composition and hyaluronidase activity. Toxicon. 2014 Nov;90:326-36. doi: 10.1016/j.toxicon.2014.08.064. Epub 2014 Sep 6.
Ref 194 Isolation of the first toxin from the scorpion Buthus occitanus israelis showing preference for Shaker potassium channels. FEBS Lett. 2007 May 29;581(13):2478-84. doi: 10.1016/j.febslet.2007.04.065. Epub 2007 Apr 30.
Ref 195 BcsTx3 is a founder of a novel sea anemone toxin family of potassium channel blocker. FEBS J. 2013 Oct;280(19):4839-52. doi: 10.1111/febs.12456. Epub 2013 Aug 23.
Ref 196 Plectasin, first animal toxin-like fungal defensin blocking potassium channels through recognizing channel pore region. Toxins (Basel). 2015 Jan 5;7(1):34-42. doi: 10.3390/toxins7010034.
Ref 197 PHAB toxins: a unique family of predatory sea anemone toxins evolving via intra-gene concerted evolution defines a new peptide fold. Cell Mol Life Sci. 2018 Dec;75(24):4511-4524. doi: 10.1007/s00018-018-2897-6. Epub 2018 Aug 14.
Ref 198 Draft genome of the filarial nematode parasite Brugia malayi. Science. 2007 Sep 21;317(5845):1756-60. doi: 10.1126/science.1145406.
Ref 199 Human beta-defensin 1, a new animal toxin-like blocker of potassium channel. Toxicon. 2016 Apr;113:1-6. doi: 10.1016/j.toxicon.2016.02.007. Epub 2016 Feb 5.
Ref 200 Studies of Conorfamide-Sr3 on Human Voltage-Gated Kv1 Potassium Channel Subtypes. Mar Drugs. 2020 Aug 13;18(8):425. doi: 10.3390/md18080425.
Ref 201 Conorfamide-Sr3, a structurally novel specific inhibitor of the Shaker K(+) channel. Toxicon. 2017 Nov;138:53-58. doi: 10.1016/j.toxicon.2017.07.024. Epub 2017 Jul 31.
Ref 202 Designed peptide analogues of the potassium channel blocker ShK toxin. Biochemistry. 2001 Dec 25;40(51):15528-37. doi: 10.1021/bi011300b.
Ref 203 Design and characterization of a highly selective peptide inhibitor of the small conductance calcium-activated K+ channel, SkCa2. J Biol Chem. 2001 Nov 16;276(46):43145-51. doi: 10.1074/jbc.M106981200. Epub 2001 Aug 29.
Ref 204 Venom composition and pain-causing toxins of the Australian great carpenter bee Xylocopa aruana. Sci Rep. 2022 Dec 22;12(1):22168. doi: 10.1038/s41598-022-26867-8.
Ref 205 Protein surface topography as a tool to enhance the selective activity of a potassium channel blocker. J Biol Chem. 2019 Nov 29;294(48):18349-18359. doi: 10.1074/jbc.RA119.010494. Epub 2019 Sep 18.
Ref 206 First report on BaltCRP, a cysteine-rich secretory protein (CRISP) from Bothrops alternatus venom: Effects on potassium channels and inflammatory processes. Int J Biol Macromol. 2019 Nov 1;140:556-567. doi: 10.1016/j.ijbiomac.2019.08.108. Epub 2019 Aug 14.
Ref 207 Durable pharmacological responses from the peptide ShK-186, a specific Kv1.3 channel inhibitor that suppresses T cell mediators of autoimmune disease. J Pharmacol Exp Ther. 2012 Sep;342(3):642-53. doi: 10.1124/jpet.112.191890. Epub 2012 May 25.
Ref 208 Distribution and kinetics of the Kv1.3-blocking peptide HsTX1[R14A] in experimental rats. Sci Rep. 2017 Jun 16;7(1):3756. doi: 10.1038/s41598-017-03998-x.
Ref 209 A Biodistribution Study of the Radiolabeled Kv1.3-Blocking Peptide DOTA-HsTX1[R14A] Demonstrates Brain Uptake in a Mouse Model of Neuroinflammation. Mol Pharm. 2023 Jan 2;20(1):255-266. doi: 10.1021/acs.molpharmaceut.2c00614. Epub 2022 Nov 4.
Ref 210 AgTx2-GFP, Fluorescent Blocker Targeting Pharmacologically Important K(v)1.x (x = 1, 3, 6) Channels. Toxins (Basel). 2023 Mar 18;15(3):229. doi: 10.3390/toxins15030229.
Ref 211 Artificial pore blocker acts specifically on voltage-gated potassium channel isoform K(V)1.6. J Biol Chem. 2022 Nov;298(11):102467. doi: 10.1016/j.jbc.2022.102467. Epub 2022 Sep 8.
Ref 212 Structural similarity between defense peptide from wheat and scorpion neurotoxin permits rational functional design. J Biol Chem. 2014 May 16;289(20):14331-40. doi: 10.1074/jbc.M113.530477. Epub 2014 Mar 26.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.