Peptide Information

General Information of This Peptide
Peptide ID
BTDP008483
Peptide Name
Potassium channel toxin alpha-KTx 2.2
Symonym
Margatoxin
Species
Centruroides margaritatus (Central American bark Scorpion)
Uniprot Name
KAX22_CENMA
Alphafold ID
P40755
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1MTX
Sequence
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH
   Click to Show/Hide
Sequence Length
39
Mass (Da)
4185
Sequence Removed Signal Peptide
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH
   Click to Show/Hide
Disulfide Bond
7-29;13-34;17-36
PDB ID
1MTX
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Arthropoda
Class: Arachnida
Order: Scorpiones
Family: Buthidae
Genus: Centruroides
Species: Centruroides margaritatus
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Kv1.2 Dissociation constant
6 pM
 .
Blocker
 [1]
 Target Info    Kv1.3 Dissociation constant
0.011 nM
 .
Blocker
 [1]
 Target Info    Kv1.1 Dissociation constant
4.2 nM
 .
Blocker
 [1]
 Target Info    Shaker-IR Dissociation constant
160 nM
 .
Blocker
 [2], [3], [4], [5]
 Target Info    Shaker Dissociation constant
160 nM
 .
Blocker
 [6- 17]
 Target Info    Kir1.1 Inhibition rate .
2.5 μM
Blocker
 [18]
 Target Info    Kir3.1/3.4 Inhibition rate .
1 μM
Blocker
 [19], [20], [21], [22]
 Target Info    Kv1.1 IC50
0.144 nM
 .
Blocker
 [19], [20], [21], [22]
 Target Info    Kv1.1 IC50
0.144 nM
 .
Blocker
 [2], [3], [4], [5]
 Target Info    Kv1.3 IC50
0.23 nM
 .
Blocker
 [19], [20], [21], [22]
 Target Info    Kv1.3 IC50
0.23 nM
 .
Blocker
 [2], [3], [4], [5]
 Target Info    Kv1.2 IC50
0.675 nM
 .
Blocker
 [19], [20], [21], [22]
 Target Info    Kv1.2 IC50
0.675 nM
 .
Blocker
 [2], [3], [4], [5]
References
Ref 1 Margatoxin is a non-selective inhibitor of human Kv1.3 K+ channels. Toxicon. 2014 Sep;87:6-16. doi: 10.1016/j.toxicon.2014.05.002. Epub 2014 May 28.
Ref 2 Purification, characterization, and biosynthesis of margatoxin, a component of Centruroides margaritatus venom that selectively inhibits voltage-dependent potassium channels. J Biol Chem. 1993 Sep 5;268(25):18866-74.
Ref 3 Chemical synthesis and structure-function studies of margatoxin, a potent inhibitor of voltage-dependent potassium channel in human T lymphocytes. Biochem Biophys Res Commun. 1994 Jan 28;198(2):619-25. doi: 10.1006/bbrc.1994.1090.
Ref 4 Subunit composition of brain voltage-gated potassium channels determined by hongotoxin-1, a novel peptide derived from Centruroides limbatus venom. J Biol Chem. 1998 Jan 30;273(5):2639-44. doi: 10.1074/jbc.273.5.2639.
Ref 5 Determination of the three-dimensional structure of margatoxin by 1H, 13C, 15N triple-resonance nuclear magnetic resonance spectroscopy. Biochemistry. 1994 Dec 20;33(50):15061-70. doi: 10.1021/bi00254a015.
Ref 6 Synthesis of Novel cis-2-Azetidinones from imines and aclychloride using triethylamine. Acta Chim Slov. 2023 Dec 4;70(4):628-633. doi: 10.17344/acsi.2023.8451.
Ref 7 Backward-Eulerian Footprint Modelling Based on the Adjoint Equation for Atmospheric and Urban-Terrain Dispersion. Boundary Layer Meteorol. 2023;188(1):159-183. doi: 10.1007/s10546-023-00807-z. Epub 2023 Apr 17.
Ref 8 Leaf spot on Alocasia macrorrhizos caused by Fusarium asiaticum in Sichuan, China. Plant Dis. 2022 Sep 11. doi: 10.1094/PDIS-04-22-0844-PDN. Online ahead of print.
Ref 9 Incidence and predictors of chronic kidney disease in type-II diabetes mellitus patients attending at the Amhara region referral hospitals, Ethiopia: A follow-up study. PLoS One. 2022 Jan 26;17(1):e0263138. doi: 10.1371/journal.pone.0263138. eCollection 2022.
Ref 10 A Method for More Accurate Determination of Resonance Frequency of the Cardiovascular System, and Evaluation of a Program to Perform It. Appl Psychophysiol Biofeedback. 2022 Mar;47(1):17-26. doi: 10.1007/s10484-021-09524-0. Epub 2021 Oct 16.
Ref 11 First Report of Fusarium wilt of Coleus forskohlii Caused by Fusarium oxysporum in China. Plant Dis. 2021 Jan 26. doi: 10.1094/PDIS-11-20-2489-PDN. Online ahead of print.
Ref 12 Shock waves from the inhomogeneous Boltzmann equation. Phys Rev E. 2019 Dec;100(6-1):062120. doi: 10.1103/PhysRevE.100.062120.
Ref 13 Classifying Changes to Preventive Interventions: Applying Adaptation Taxonomies. J Prim Prev. 2019 Feb;40(1):89-109. doi: 10.1007/s10935-018-00531-2.
Ref 14 Quantification of the passive and active biaxial mechanical behaviour and microstructural organization of rat thoracic ducts. J R Soc Interface. 2015 Jul 6;12(108):20150280. doi: 10.1098/rsif.2015.0280.
Ref 15 A model of mechanical interactions between heart and lungs. Philos Trans A Math Phys Eng Sci. 2009 Dec 13;367(1908):4741-57. doi: 10.1098/rsta.2009.0137.
Ref 16 Experimental test of nonlocal realistic theories without the rotational symmetry assumption. Phys Rev Lett. 2007 Nov 23;99(21):210406. doi: 10.1103/PhysRevLett.99.210406. Epub 2007 Nov 21.
Ref 17 Structures and phase transitions of the A7PSe6 (A = ag, Cu) argyrodite-type ionic conductors. III. alpha-Cu7PSe6. Acta Crystallogr B. 2000 Dec;56 (Pt 6):972-9. doi: 10.1107/s0108768100010260.
Ref 18 Purification, characterization, and synthesis of an inward-rectifier K+ channel inhibitor from scorpion venom. Biochemistry. 1997 Jun 10;36(23):6936-40. doi: 10.1021/bi9702849.
Ref 19 Novel components of Tityus serrulatus venom: A transcriptomic approach. Toxicon. 2021 Jan 15;189:91-104. doi: 10.1016/j.toxicon.2020.11.001. Epub 2020 Nov 10.
Ref 20 Isolation and characterization of Ts19 Fragment II, a new long-chain potassium channel toxin from Tityus serrulatus venom. Peptides. 2016 Jun;80:9-17. doi: 10.1016/j.peptides.2015.06.004. Epub 2015 Jun 25.
Ref 21 Tityus serrulatus venom peptidomics: assessing venom peptide diversity. Toxicon. 2008 Oct;52(5):611-8. doi: 10.1016/j.toxicon.2008.07.010. Epub 2008 Jul 31.
Ref 22 Influence of post-starvation extraction time and prey-specific diet in Tityus serrulatus scorpion venom composition and hyaluronidase activity. Toxicon. 2014 Nov;90:326-36. doi: 10.1016/j.toxicon.2014.08.064. Epub 2014 Sep 6.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.