General Information of This Peptide
Peptide ID
BTDP000913
Peptide Name
MeuKTx (G11R,G30R,D33H)
Symonym
MeuKTx (G11R,G30R,D33H)
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Original Sequence
VGINVKCKHSGQCLKPCKDAGMRFGKCINGKCDCTPK
   Click to Show/Hide
Mutant Sequence
VGINVKCKHSRQCLKPCKDAGMRFGKCMNRKCHCTPK
   Click to Show/Hide
Sequence Length
37
Mass(Da)
4201
Sequence Removed Signal Peptide
VGINVKCKHSRQCLKPCKDAGMRFGKCMNRKCHCTPK
   Click to Show/Hide
        Click to Show/Hide the Complete Species Lineage
N.A.
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Kv1 IC50
0.11 nM
.
Blocker
[1- 20]
 Target Info    Kv1.3 IC50
8.1 nM
.
Blocker
[1- 20]
 Target Info    Kv1.2 IC50
10.7 nM
.
Blocker
[1- 20]
 Target Info    Kv1.6 IC50
16.3 nM
.
Blocker
[1- 20]
References
Ref 1 Retraction: Role of mesenchymal stem cells versus angiotensin converting enzyme inhibitor in kidney repair. Nephrology (Carlton). 2024 Apr;29(4):239. doi: 10.1111/nep.14278. Epub 2024 Feb 11.
Ref 2 Photogeneration and quenching of singlet molecular oxygen by bacterial C(40) carotenoids with long chain of conjugated double bonds. Photosynth Res. 2024 Mar;159(2-3):291-301. doi: 10.1007/s11120-023-01070-6. Epub 2024 Feb 5.
Ref 3 Density Functional Theory, Molecular Dynamics and AlteQ Studies Approaches of Baimantuoluoamide A and Baimantuoluoamide B to Identify Potential Inhibitors of M(pro) Proteins: a Novel Target for the Treatment of SARS COVID-19. JETP Lett. 2023 May 15:1-10. doi: 10.1134/S0021364023600039. Online ahead of print.
Ref 4 Melatonin Confers NaCl Tolerance in Withaniacoagulans L. by Maintaining Na(+)/K(+) Homeostasis, Strengthening the Antioxidant Defense System and Modulating Withanolides Synthesis-Related Genes. Russ J Plant Physiol. 2023;70(3):52. doi: 10.1134/S1021443723600125. Epub 2023 May 23.
Ref 5 Rhodococcus rhodochrous IEGM 1360, an Effective Biocatalyst of C3 Oxidative Transformation of Oleanane Triterpenoids. Microbiology (N Y). 2023;92(2):204-214. doi: 10.1134/S0026261722603360. Epub 2023 Apr 21.
Ref 6 Quaternary Ammonium Salt Strategy and Molecular Docking Studies of Novel 5-Acyl-8-(Arylamino)-Quinolines by Acetyl and Methanesulfonyl Chloride for Dual Evaluation Bioactivity. Russ J Bioorg Chem. 2023;49(2):367-375. doi: 10.1134/S1068162023020097. Epub 2023 Feb 21.
Ref 7 Erratum to: Prospects for the Use of Marine Sulfated Fucose-Rich Polysaccharides in Treatment and Prevention of COVID-19 and Post-COVID-19 Syndrome. Russ J Bioorg Chem. 2022;48(6):1372. doi: 10.1134/S1068162022340015. Epub 2022 Dec 23.
Ref 8 Current Trends and Approaches to the Search for Genetic Determinants of Aging and Longevity. Russ J Genet. 2022;58(12):1427-1443. doi: 10.1134/S1022795422120067. Epub 2022 Dec 28.
Ref 9 Design, Synthesis, Anti-Tubercular Evaluation and Teratogenicity Studies of Furanyl Pyrazolo[3,4-b] Quinoline-5-Ones. Russ J Bioorg Chem. 2023;49(1):127-138. doi: 10.1134/S1068162023010053. Epub 2022 Dec 22.
Ref 10 Rapid Assessment of Neutralizing Antibodies Using Influenza Viruses with a Luciferase Reporter. Appl Biochem Microbiol. 2022;58(7):878-886. doi: 10.1134/S0003683822070067. Epub 2022 Dec 6.
Ref 11 Analysis of adiabatic trapping phenomena for quasi-integrable area-preserving maps in the presence of time-dependent exciters. Phys Rev E. 2022 Sep;106(3-1):034204. doi: 10.1103/PhysRevE.106.034204.
Ref 12 Synthesis, Antiviral, and Antibacterial Activity of the Glycyrrhizic Acid and Glycyrrhetinic Acid Derivatives. Russ J Bioorg Chem. 2022;48(5):906-918. doi: 10.1134/S1068162022050132. Epub 2022 Jul 28.
Ref 13 Erratum to: Evaluation of the Effects of Favipiravir Combined with Vitamin C on Alveolar Bone in Rats. J Evol Biochem Physiol. 2022;58(3):941. doi: 10.1134/S0022093022030280. Epub 2022 Jun 29.
Ref 14 Design, Synthesis, and Molecular Docking Studies of Some New Quinoxaline Derivatives as EGFR Targeting Agents. Russ J Bioorg Chem. 2022;48(3):565-575. doi: 10.1134/S1068162022030220. Epub 2022 Jun 21.
Ref 15 Identification of Some Promising Heterocycles Useful in Treatment of Allergic Rhinitis: Virtual Screening, Pharmacophore Mapping, Molecular Docking, and Molecular Dynamics. Russ J Bioorg Chem. 2022;48(2):438-456. doi: 10.1134/S1068162022330019. Epub 2022 May 26.
Ref 16 Erratum to: Experimental Search for New Means of Pathogenetic Therapy COVID-19: Inhibitor of H2-Receptors Famotidine Increases the Effect of Oseltamivir on Survival and Immune Status of Mice Infected by A/PR/8/34 (H1N1). J Evol Biochem Physiol. 2022;58(2):623. doi: 10.1134/S0022093022020284. Epub 2022 May 16.
Ref 17 MicroRNAs as the Potential Regulators of SARS-CoV-2 Infection and Modifiers of the COVID-19 Clinical Features. Mol Biol. 2022;56(1):29-45. doi: 10.1134/S0026893322010034. Epub 2022 Feb 12.
Ref 18 Predators as Control Agents of Mosquito Larvae in Micro-Reservoirs (Review). Inland Water Biol. 2022;15(1):39-53. doi: 10.1134/S1995082922010138. Epub 2022 Mar 12.
Ref 19 Molecular Beacon DNA Probes with Fluorescein Bifluorophore. Russ J Bioorg Chem. 2021;47(3):734-740. doi: 10.1134/S1068162021030055. Epub 2021 Jun 11.
Ref 20 Synthesis, Molecular Docking, In Silico ADME Predictions, and Toxicity Studies of N-Substituted-5-(4-Chloroquinolin-2-yl)-1,3,4-Thiadiazol-2-Amine Derivatives as COVID-19 Inhibitors. Russ J Bioorg Chem. 2021;47(1):158-165. doi: 10.1134/S1068162021010155. Epub 2021 Mar 20.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.