Peptide Information
General Information of This Peptide
| Peptide ID |
BTDP008710
|
|||||
|---|---|---|---|---|---|---|
| Peptide Name |
KappaPI-actitoxin-Ael3a
|
|||||
| Symonym |
Kunitz-type serine protease inhibitor APEKTx1
|
|||||
| Species |
Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima)
|
|||||
| Uniprot Name | ||||||
| Alphafold ID | ||||||
| 3D Structure |
|
|||||
| Sequence |
INSICLLPKKQGFCRARFPRFYYNSSTRRCEMFYYGGCGGNANNFNTLEECEKVCLGYGE
AWKAP Click to Show/Hide
|
|||||
| Sequence Length |
65
|
|||||
| Mass (Da) |
7475
|
|||||
| Sequence Removed Signal Peptide |
INSICLLPKKQGFCRARFPRFYYNSSTRRCEMFYYGGCGGNANNFNTLEECEKVCLGYGE
AWKAP Click to Show/Hide
|
|||||
| Disulfide Bond |
5-55;14-38;30-51
|
|||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Full List of Activity Data of This Peptide Toxin
| Target Name | Activity Data Type | Activity Data | Concentration | Note | Reference |
|---|---|---|---|---|---|
| Target Info trypsin | Dissociation constant |
124 nM
|
. | . | [1], [2] |
| Target Info Shaker | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv1.2 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv1.4 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv2.1 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv1.6 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv1.5 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv1.3 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv4.1 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv11 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv4.3 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv4.2 | Inhibition rate | . |
1 μM
|
. | [1], [2] |
| Target Info Kv1 | IC50 |
0.9 nM
|
. | . | [1], [2] |
| Target Info Kv1 | IC50 |
0.9 nM
|
. | . | [1], [2] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
