Peptide Information
General Information of This Peptide
| Peptide ID |
BTDP008401
|
|||||
|---|---|---|---|---|---|---|
| Peptide Name |
Kunitz-type conkunitzin-S1
|
|||||
| Symonym |
Conk-S1
|
|||||
| Species |
Conus striatus (Striated cone)
|
|||||
| Uniprot Name | ||||||
| Alphafold ID | ||||||
| 3D Structure |
|
|||||
| Sequence |
MEGRRFAAVLILTICMLAPGTGTLLPKDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLR
FDYTGQGGNENNFRRTYDCQRTCLYT Click to Show/Hide
|
|||||
| Sequence Length |
86
|
|||||
| Mass (Da) |
9661
|
|||||
| Signal Sequence |
MEGRRFAAVLILPICMLAPGAVA
Click to Show/Hide
|
|||||
| Sequence Removed Signal Peptide |
LLPKDRPSLCDLPADSGSGTKAEKRIYYNSARKQCLRFDYTGQGGNENNFRRTYDCQRTC
LYT Click to Show/Hide
|
|||||
| Disulfide Bond |
33-83;58-79
|
|||||
| PDB ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Full List of Activity Data of This Peptide Toxin
| Target Name | Activity Data Type | Activity Data | Concentration | Note | Reference |
|---|---|---|---|---|---|
| Target Info Kv1.1 | Inhibition rate | . |
20 μM
|
. | [1], [2], [3] |
| Target Info Kv1.6 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info Kv2.1 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info Kv1.3 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info Kv1.4 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info Kv1.5 | Inhibition rate | . |
50 μM
|
. | [1], [2], [3] |
| Target Info Kv3.2 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info Kv4.1 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info KCa1.1 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info Kv10.1 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info KCa1.1 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info Kv3.4 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info Kv2.3 | Inhibition rate | . |
100 μM
|
. | [1], [2], [3] |
| Target Info Kv10.2 | Inhibition rate | . |
30 μM
|
. | [1], [2], [3] |
| Target Info Kv4.2 | Inhibition rate | . |
1 μM
|
. | [1], [2], [3] |
| Target Info Kv1.3 | Inhibition rate |
15 %
|
5 μM
|
. | [1], [2], [3] |
| Target Info Kv1 | Inhibition rate |
20 %
|
5 μM
|
. | [1], [2], [3] |
| Target Info Kv1.7 | Inhibition rate |
65 %
|
1 μM
|
. | [1], [2], [3] |
| Target Info Kv1.2 | Inhibition rate |
70 %
|
5 μM
|
. | [1], [2], [3] |
| Target Info ShakerKD | Effective concentration 50 |
0.95 nM
|
. | . | [1], [2], [3] |
| Target Info Shaker-IR | IC50 |
0.95 nM
|
. | . | [1], [2], [3] |
| Target Info Shaker-IR | IC50 |
1.33 nM
|
. | . | [1], [2], [3] |
| Target Info Kv1.7-1.2 | IC50 |
180 nM
|
. | . | [1], [2], [3] |
| Target Info Kv1.7-1.2 | IC50 |
390 nM
|
. | . | [1], [2], [3] |
| Target Info Kv1.7 | IC50 |
439 nM
|
. | . | [1], [2], [3] |
| Target Info Shaker | IC50 |
502 nM
|
. | . | [1], [2], [3] |
| Target Info Kv1.2 | IC50 |
3.4 μM
|
. | . | [1], [2], [3] |
| Target Info Kv1.2 | IC50 |
4.18 μM
|
. | . | [1], [2], [3] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
