Peptide Information
General Information of This Peptide
| Peptide ID |
BTDP008564
|
|||||
|---|---|---|---|---|---|---|
| Peptide Name |
Toxin PhcrTx2
|
|||||
| Species |
Phymanthus crucifer (Red beaded anemone)
|
|||||
| Uniprot Name | ||||||
| Alphafold ID | ||||||
| 3D Structure |
|
|||||
| Sequence |
ALPCRCEGKTEYGDKWIFHGGCPNDYGYNDRCFMKPGSVCCYPKYE
Click to Show/Hide
|
|||||
| Sequence Length |
46
|
|||||
| Mass (Da) |
5303
|
|||||
| Sequence Removed Signal Peptide |
ALPCRCEGKTEYGDKWIFHGGCPNDYGYNDRCFMKPGSVCCYPKYE
Click to Show/Hide
|
|||||
| Disulfide Bond |
4-40;6-32;22-41
|
|||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Full List of Activity Data of This Peptide Toxin
| Target Name | Activity Data Type | Activity Data | Concentration | Note | Reference |
|---|---|---|---|---|---|
| Target Info Kv1 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.1 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.2 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.3 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.4 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.6 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.4 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.6 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv2.1 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv3.1 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv4.2 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv2.1 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv11.1 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Shaker-IR | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Shaker-IR | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.5 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.3 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv3.1 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv4.2 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv10 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv1.2 | Inhibition rate | . |
5 μM
|
. | [1] |
| Target Info Kv | IC50 |
6.4 μM
|
. | . | [1] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
