Target Information
General Information of This Target
| Target ID |
BTDT00046
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Potassium voltage-gated channel subfamily A member 1 (Kcna1)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
Kcna1
|
|||||
| Gene ID | ||||||
| Synonym |
RBKI; RCK1; Voltage-gated potassium channel subunit Kv1.1
|
|||||
| Sequence |
MTVMSGENADEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS IVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRF FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE GEEQAQLLHVSSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTA TDQNCVNKSKLLTDV Click to Show/Hide
|
|||||
| Family |
the potassium channel family
|
|||||
| Function |
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney. Contributes to the regulation of the membrane potential and nerve signaling, and prevents neuronal hyperexcitability. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA1 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heterotetrameric channel formed by KCNA1 and KCNA4 shows rapid inactivation. Regulates neuronal excitability in hippocampus, especially in mossy fibers and medial perforant path axons, preventing neuronal hyperexcitability. Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA) release. Plays a role in regulating the generation of action potentials and preventing hyperexcitability in myelinated axons of the vagus nerve, and thereby contributes to the regulation of heart contraction. Required for normal neuromuscular responses. Regulates the frequency of neuronal action potential firing in response to mechanical stimuli, and plays a role in the perception of pain caused by mechanical stimuli, but does not play a role in the perception of pain due to heat stimuli. Required for normal responses to auditory stimuli and precise location of sound sources, but not for sound perception. The use of toxins that block specific channels suggest that it contributes to the regulation of the axonal release of the neurotransmitter dopamine. Required for normal postnatal brain development and normal proliferation of neuronal precursor cells in the brain. Plays a role in the reabsorption of Mg(2+) in the distal convoluted tubules in the kidney and in magnesium ion homeostasis, probably via its effect on the membrane potential.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Potassium channel toxin Bgk (K25[Dab]) | . | . | [1] |
| Toxin Info Potassium channel toxin Bgk (K25[Dap]) | . | . | [1] |
| Toxin Info Potassium channel toxin Bgk (K25[Nle]) | . | . | [1] |
| Toxin Info Bgk (W5Y,Y26F) | Dissociation constant |
5 pM
|
[2] |
| Toxin Info Potassium channel toxin Bgk (W5Y,F6A,Y26F) | Dissociation constant |
0.071 nM
|
[2] |
| Toxin Info Kunitz-type serine protease inhibitor homolog delta-dendrotoxin | Dissociation constant |
0.1 nM
|
[3], [4] |
| Toxin Info Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | Dissociation constant |
1.1 nM
|
[3- 7] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | Dissociation constant |
1.1 nM
|
[8- 12] |
| Toxin Info Potassium channel toxin Bgk (K25[Orn]) | Dissociation constant |
20 nM
|
[1] |
| Toxin Info Potassium channel toxin Bgk (K25A,Y26A) | Dissociation constant |
157 nM
|
[1] |
| Toxin Info Potassium channel toxin alpha-KTx 11.2 | Dissociation constant |
1 μM
|
[13], [14] |
| Toxin Info Potassium channel toxin alpha-KTx 11.3 | Dissociation constant |
1 μM
|
[14] |
| Toxin Info PBTx1 (T24F,V26K) | Dissociation constant |
1.1 μM
|
[14] |
| Toxin Info Potassium channel toxin alpha-KTx 11.1 | Dissociation constant |
21 μM
|
[13], [14], [15] |
| Toxin Info Potassium channel toxin alpha-KTx 1.10 | Dissociation constant |
79 μM
|
[16], [17], [18] |
| Toxin Info Potassium channel toxin alpha-KTx 3.2 | Inhibition constant |
0.044 nM
|
[8- 21] |
| Toxin Info Potassium channel toxin alpha-KTx 10.2 | Inhibition constant |
0.087 nM
|
[22] |
| Toxin Info Potassium channel toxin alpha-KTx 2.7 | Inhibition constant |
0.1 nM
|
[23] |
| Toxin Info Potassium channel toxin alpha-KTx 2.3 | Inhibition constant |
0.1 nM
|
[23], [24] |
| Toxin Info Potassium channel toxin alpha-KTx 10.1 | Inhibition constant |
0.109 nM
|
[22], [25] |
| Toxin Info Venom basic protease inhibitor K (A27K) | Inhibition constant |
0.14 nM
|
[26] |
| Toxin Info Venom basic protease inhibitor K (R52A) | Inhibition constant |
0.18 nM
|
[26] |
| Toxin Info Venom basic protease inhibitor 1 homolog (N12D,K28A,K29A,K30G) | Inhibition constant |
0.22 nM
|
[27] |
| Toxin Info Potassium channel toxin alpha-KTx 1.2 | Inhibition constant |
0.25 nM
|
[28], [29], [30] |
| Toxin Info Kunitz-type serine protease inhibitor homolog dendrotoxin K | Inhibition constant |
0.29 nM
|
[26- 36] |
| Toxin Info Venom basic protease inhibitor K (R53A) | Inhibition constant |
0.57 nM
|
[26] |
| Toxin Info Venom basic protease inhibitor K (K17A) | Inhibition constant |
0.74 nM
|
[35] |
| Toxin Info Venom basic protease inhibitor K (K15Y) | Inhibition constant |
0.79 nM
|
[35] |
| Toxin Info Venom basic protease inhibitor K (R16A) | Inhibition constant |
0.8 nM
|
[35] |
| Toxin Info Venom basic protease inhibitor K (K28A) | Inhibition constant |
0.84 nM
|
[26] |
| Toxin Info Venom basic protease inhibitor K (K24A) | Inhibition constant |
0.94 nM
|
[26] |
| Toxin Info Venom basic protease inhibitor 1 homolog (N12D,K28A,K29A,K30G) | Inhibition constant |
1.37 nM
|
[27] |
| Toxin Info Venom basic protease inhibitor 1 homolog (H10A) | Inhibition constant |
1.6 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (N12D) | Inhibition constant |
2.13 nM
|
[27] |
| Toxin Info Venom basic protease inhibitor 1 homolog (K19A) | Inhibition constant |
2.3 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (K48A) | Inhibition constant |
2.8 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor K (W25A) | Inhibition constant |
2.8 nM
|
[26] |
| Toxin Info Venom basic protease inhibitor 1 homolog (Q27A) | Inhibition constant |
2.9 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (R11A) | Inhibition constant |
3 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (D18A) | Inhibition constant |
3.4 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (I58A) | Inhibition constant |
3.45 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (E51A) | Inhibition constant |
3.65 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (Q31A) | Inhibition constant |
3.65 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (Y17A) | Inhibition constant |
3.7 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor K (K6A) | Inhibition constant |
3.9 nM
|
[26] |
| Toxin Info Venom basic protease inhibitor 1 homolog (R55A) | Inhibition constant |
4 nM
|
[37] |
| Toxin Info Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | Inhibition constant |
4 nM
|
[3- 7] |
| Toxin Info Venom basic protease inhibitor 1 homolog (R15A) | Inhibition constant |
4.6 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (N12D) | Inhibition constant |
4.76 nM
|
[27] |
| Toxin Info Venom basic protease inhibitor 1 homolog (D36A) | Inhibition constant |
4.85 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (E33A) | Inhibition constant |
5.3 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (R54A) | Inhibition constant |
5.4 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (S44A) | Inhibition constant |
6.7 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (R34A) | Inhibition constant |
7.1 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor K (W25Q,A27K) | Inhibition constant |
9.7 nM
|
[35] |
| Toxin Info Venom basic protease inhibitor 1 homolog (P2A) | Inhibition constant |
10.6 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (S38A) | Inhibition constant |
23.5 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (R3A) | Inhibition constant |
28.5 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (R4A) | Inhibition constant |
38 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (L6A) | Inhibition constant |
43.4 nM
|
[37] |
| Toxin Info Potassium channel toxin alpha-KTx 16.5 | Inhibition constant |
50 nM
|
[30] |
| Toxin Info Venom basic protease inhibitor K (K26A) | Inhibition constant |
51 nM
|
[26] |
| Toxin Info Venom basic protease inhibitor K (K17A,K26A) | Inhibition constant |
88 nM
|
[35] |
| Toxin Info Potassium channel toxin alpha-KTx 2.4 | Inhibition constant |
100 nM
|
[38] |
| Toxin Info Venom basic protease inhibitor 1 homolog (I8A) | Inhibition constant |
118 nM
|
[37] |
| Toxin Info Potassium channel toxin alpha-KTx 3.4 | Inhibition constant |
136 nM
|
[19- 39] |
| Toxin Info Venom basic protease inhibitor K (P13Q,K26A,K28A) | Inhibition constant |
140 nM
|
[35] |
| Toxin Info Venom basic protease inhibitor K (K3A) | Inhibition constant |
324 nM
|
[26] |
| Toxin Info Venom basic protease inhibitor 1 homolog (K5[Orn]) | Inhibition constant |
471 nM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (R46A) | Inhibition constant |
562 nM
|
[37] |
| Toxin Info Potassium channel toxin alpha-KTx 1.1 | Inhibition constant |
1.5 μM
|
[8- 53] |
| Toxin Info Venom basic protease inhibitor 1 homolog (L9A) | Inhibition constant |
4.16 μM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (K5[Nle]) | Inhibition constant |
5.7 μM
|
[37] |
| Toxin Info Venom basic protease inhibitor 1 homolog (K5A) | Inhibition constant |
5.8 μM
|
[37] |
| Toxin Info N.vectensis toxin 4 | Effect | . | [54] |
| Toxin Info N.vectensis toxin 5 | Effect | . | [54] |
| Toxin Info Potassium channel toxin Aek | Inhibition rate | . | [55] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | Inhibition rate | . | [56] |
| Toxin Info KTX-1 (G7L,S8P,P9Q,L12I,R28K,H31R) | Inhibition rate | . | [8] |
| Toxin Info MTX (G18G[Abu],G33G[Abu]) | Inhibition rate | . | [57] |
| Toxin Info HelaTx1 (A1S) | Inhibition rate | . | [58] |
| Toxin Info HelaTx1 (G8A) | Inhibition rate | . | [58] |
| Toxin Info Potassium channel toxin alpha-KTx 3.4 | Inhibition rate | . | [56] |
| Toxin Info HelaTx1 (K13A) | Inhibition rate | . | [58] |
| Toxin Info HelaTx1 (K14A) | Inhibition rate | . | [58] |
| Toxin Info HelaTx1 (K18A) | Inhibition rate | . | [58] |
| Toxin Info HelaTx1 (R10A) | Inhibition rate | . | [58] |
| Toxin Info HelaTx1 (R11A) | Inhibition rate | . | [58] |
| Toxin Info Mu-conotoxin CnIIIC | Inhibition rate | . | [59], [60], [61] |
| Toxin Info Defensin-like protein 1 | Inhibition rate | . | [62] |
| Toxin Info Kappa-conotoxin PVIIA | Inhibition rate | . | [63- 74] |
| Toxin Info Mesomartoxin | Inhibition rate | . | [75] |
| Toxin Info Mu-conotoxin GIIIA | Inhibition rate | . | [76- 88] |
| Toxin Info Potassium channel toxin alpha-KTx 13.2 | Inhibition rate | . | [89] |
| Toxin Info Toxin PhcrTx2 | Inhibition rate | . | [90] |
| Toxin Info Apamin | Inhibition rate | . | [91- 108] |
| Toxin Info Potassium channel toxin alpha-KTx 20.1 | Inhibition rate | . | [109] |
| Toxin Info Potassium channel toxin alpha-KTx 3.12 | Inhibition rate | . | [110] |
| Toxin Info Potassium channel toxin alpha-KTx 15.2 | Inhibition rate | . | [111] |
| Toxin Info Potassium channel toxin alpha-KTx 19.1 | Inhibition rate | . | [112] |
| Toxin Info Potassium channel toxin alpha-KTx 8.5 | Inhibition rate | . | [113] |
| Toxin Info Potassium channel toxin alpha-KTx 8.6 | Inhibition rate | . | [114], [115] |
| Toxin Info Potassium channel toxin alpha-KTx 8.8 | Inhibition rate | . | [116] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.1 | Inhibition rate | . | [117] |
| Toxin Info Potassium channel toxin alpha-KTx 3.11 | Inhibition rate | . | [118] |
| Toxin Info Potassium channel toxin alpha-KTx 6.4 | Inhibition rate | . | [119] |
| Toxin Info Potassium channel toxin kappa-KTx 1.3 | Inhibition rate | . | [120] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.2 | Inhibition rate | . | [117] |
| Toxin Info Potassium channel toxin kappa-KTx 2.5 | Inhibition rate | . | [121] |
| Toxin Info Potassium channel toxin TsTXK-beta | Inhibition rate | . | [122] |
| Toxin Info U-actitoxin-Oulsp1 | Inhibition rate | . | [123] |
| Toxin Info U-actitoxin-Oulsp1 | Inhibition rate | . | [124] |
| Toxin Info Potassium channel toxin alpha-KTx 16.4 | Inhibition rate | . | [125] |
| Toxin Info HelaTx1 | Inhibition rate | . | [58] |
| Toxin Info Potassium channel toxin Bgk (K25A) | Inhibition rate | . | [126] |
| Toxin Info Potassium channel toxin kappa-KTx 1.2 | Inhibition rate | . | [120- 130] |
| Toxin Info Neurotoxin lambda-MeuTx | Inhibition rate | . | [131] |
| Toxin Info Potassium channel toxin alpha-KTx 6.1 | Inhibition rate | . | [132] |
| Toxin Info MTX (S2V,C3I,T4G,G5Q,S6R,K7C,D8T,C9G,Y10S,A11K,P12D,R14Y,K15A,Q16P,T17C,G18R,C19K,P20Q,N21T,A22G,K23C,C24P,I25N,N26A,S28C,C29I,K30N,C31K,Y32S,G33C,C34K) | Inhibition rate | . | [133] |
| Toxin Info Potassium channel toxin alpha-KTx 16.8 | Inhibition rate | . | [134] |
| Toxin Info Potassium channel toxin alpha-KTx 16.9 | Inhibition rate | . | [134] |
| Toxin Info Potassium channel toxin alpha-KTx 3.6 | Inhibition rate |
>0 %
|
[46- 138] |
| Toxin Info Calcium channel toxin-like peptide-1 | Inhibition rate |
8 %
|
[131] |
| Toxin Info Potassium channel toxin kappa-KTx 2.2 | Inhibition rate |
8 %
|
[139] |
| Toxin Info Potassium channel toxin alpha-KTx 12.2 | Inhibition rate |
9 %
|
[140] |
| Toxin Info Potassium channel toxin alpha-KTx 12.1 | Inhibition rate |
9 %
|
[140] |
| Toxin Info Pi-stichotoxin-Hcr5b | Inhibition rate |
10 %
|
[141] |
| Toxin Info Potassium channel toxin alpha-KTx 21.1 | Inhibition rate |
10 %
|
[142] |
| Toxin Info Kappa-hefutoxin 3 | Inhibition rate |
10.7 %
|
[120] |
| Toxin Info Potassium channel toxin kappa-KTx 2.2 | Inhibition rate |
17 %
|
[139] |
| Toxin Info Kunitz-type conkunitzin-S1 | Inhibition rate |
20 %
|
[143], [144], [145] |
| Toxin Info Kappa-scoloptoxin(15)-Ssd2a | Inhibition rate |
20 %
|
[146] |
| Toxin Info Kappa-scoloptoxin(11)-Ssm3a | Inhibition rate |
25 %
|
[147] |
| Toxin Info Mu-conotoxin SIIIA | Inhibition rate |
27 %
|
[59- 172] |
| Toxin Info Potassium channel toxin alpha-KTx 3.18 | Inhibition rate |
30 %
|
[115] |
| Toxin Info Potassium channel toxin alpha-KTx 31.1 | Inhibition rate |
32 %
|
[173] |
| Toxin Info Potassium channel toxin alpha-KTx 31.1 | Inhibition rate |
32 %
|
[173] |
| Toxin Info Kunitz-type serine protease inhibitor HCRG21 | Inhibition rate |
33 %
|
[174] |
| Toxin Info Potassium channel toxin kappa-KTx 2.3 | Inhibition rate |
33 %
|
[139] |
| Toxin Info Potassium channel toxin alpha-KTx 8.6 | Inhibition rate |
35 %
|
[114] |
| Toxin Info Potassium channel toxin MeuTXKalpha3 | Inhibition rate |
35 %
|
[175] |
| Toxin Info Potassium channel toxin alpha-KTx (N30P) | Inhibition rate |
38 %
|
[175] |
| Toxin Info Kappa-actitoxin-Bcs4a | Inhibition rate |
54 %
|
[176] |
| Toxin Info Basic phospholipase A2 homolog Gln49-PLA2 | Inhibition rate |
54.25 %
|
[177], [178], [179] |
| Toxin Info Acidic phospholipase A2 natratoxin | Inhibition rate |
57 %
|
[180] |
| Toxin Info Mu-conotoxin PIIIA | Inhibition rate |
73 %
|
[59- 184] |
| Toxin Info Mambaquaretin-7 | Inhibition rate |
80 %
|
[185] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | Inhibition rate |
85 %
|
[140] |
| Toxin Info Potassium channel toxin alpha-KTx 19.2 | Inhibition rate |
100 %
|
[186] |
| Toxin Info Potassium channel toxin alpha-KTx 3.6 | Inhibition rate |
100 %
|
[137] |
| Toxin Info Potassium channel toxin alpha-KTx 8.2 | Inhibition rate |
100 %
|
[15- 190] |
| Toxin Info Kunitz-type serine protease inhibitor homolog beta-bungarotoxin B2 chain | Effective concentration 50 |
3 nM
|
[191] |
| Toxin Info Potassium channel toxin kappa-KTx 5.1 | Effective concentration 50 |
9.9 μM
|
[192] |
| Toxin Info HgTX1 (A19[Cme]) | IC50 |
0.6 pM
|
[193] |
| Toxin Info Potassium channel toxin alpha-KTx 6.3 | IC50 |
1 pM
|
[18- 200] |
| Toxin Info HgTX1 (A19C) | IC50 |
2 pM
|
[193] |
| Toxin Info HgTX1 (A19C) | IC50 |
2 pM
|
[193] |
| Toxin Info HgTX1 (A19C) | IC50 |
3 pM
|
[193] |
| Toxin Info HgTX1 (A19C) | IC50 |
4 pM
|
[193] |
| Toxin Info HgTX1 (A19C) | IC50 |
5 pM
|
[193] |
| Toxin Info HgTX1 (A19C) | IC50 |
6.4 pM
|
[193] |
| Toxin Info HgTX1 (A19C) | IC50 |
7 pM
|
[193] |
| Toxin Info Potassium channel toxin alpha-KTx 3.13 | IC50 |
203.15 pM
|
[137] |
| Toxin Info HgTX1 (A19C) | IC50 |
0.011 nM
|
[193] |
| Toxin Info Kappa-stichotoxin-She3a | IC50 |
0.02 nM
|
[201- 216] |
| Toxin Info Potassium channel toxin alpha-KTx 3.5 | IC50 |
0.05 nM
|
[130] |
| Toxin Info Potassium channel toxin alpha-KTx 3.9 | IC50 |
0.05 nM
|
[217] |
| Toxin Info Potassium channel toxin alpha-KTx 1.5 | IC50 |
0.09 nM
|
[130- 238] |
| Toxin Info Potassium channel toxin alpha-KTx 3.17 | IC50 |
0.1 nM
|
[134] |
| Toxin Info MeuKTx (G11R,G30R,D33H) | IC50 |
0.11 nM
|
[239- 258] |
| Toxin Info Potassium channel toxin alpha-KTx 1.6 | IC50 |
0.12 nM
|
[18- 259] |
| Toxin Info Potassium channel toxin alpha-KTx 6.2 | IC50 |
0.2 nM
|
[20- 267] |
| Toxin Info Potassium channel toxin alpha-KTx 3.6 | IC50 |
0.2 nM
|
[46- 237] |
| Toxin Info Potassium channel toxin alpha-KTx 3.13 | IC50 |
0.203 nM
|
[137] |
| Toxin Info KappaPI-actitoxin-Ael3a | IC50 |
0.9 nM
|
[206- 268] |
| Toxin Info KappaPI-actitoxin-Ael3a | IC50 |
0.9 nM
|
[206- 268] |
| Toxin Info Potassium channel toxin Bgk (E8A) | IC50 |
1.5 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (Q24A) | IC50 |
1.5 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (T9A) | IC50 |
1.6 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (V1A) | IC50 |
1.6 nM
|
[126] |
| Toxin Info Potassium channel toxin alpha-KTx 3.19 | IC50 |
1.9 nM
|
[115] |
| Toxin Info Potassium channel toxin alpha-KTx 3.19 | IC50 |
1.9 nM
|
[115- 269] |
| Toxin Info Potassium channel toxin alpha-KTx 3.2 | IC50 |
2 nM
|
[8- 21] |
| Toxin Info Potassium channel toxin ShK (I4A,F15A,L25A) | IC50 |
2 nM
|
[270] |
| Toxin Info Kunitz-type serine protease inhibitor homolog dendrotoxin K | IC50 |
2.5 nM
|
[26- 36] |
| Toxin Info Potassium channel toxin Bgk (L17A) | IC50 |
2.5 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (T22A) | IC50 |
2.5 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (W5A) | IC50 |
2.7 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (S16A) | IC50 |
2.8 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (E35A) | IC50 |
3 nM
|
[126] |
| Toxin Info Kappa-stichotoxin-Hmg1a | IC50 |
3.2 nM
|
[206- 272] |
| Toxin Info Potassium channel toxin Bgk (R12A) | IC50 |
3.6 nM
|
[126] |
| Toxin Info Kappa-actitoxin-Bgr1a | IC50 |
3.6 nM
|
[1- 275] |
| Toxin Info Potassium channel toxin Bgk (N29A) | IC50 |
4.2 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (R21A) | IC50 |
4.6 nM
|
[126] |
| Toxin Info Potassium channel toxin ShK (I4A,F15A) | IC50 |
5 nM
|
[270] |
| Toxin Info Potassium channel toxin Bgk (R27A) | IC50 |
5.1 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (K15A) | IC50 |
5.5 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (K32A) | IC50 |
5.5 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (K7A) | IC50 |
5.7 nM
|
[126] |
| Toxin Info Potassium channel toxin ShK (F15A) | IC50 |
6 nM
|
[203] |
| Toxin Info Potassium channel toxin ShK (K9Q) | IC50 |
6 nM
|
[203] |
| Toxin Info Potassium channel toxin alpha-KTx 7.1 | IC50 |
6 nM
|
[276], [277] |
| Toxin Info Potassium channel toxin Bgk (N19A) | IC50 |
6.3 nM
|
[126] |
| Toxin Info Potassium channel toxin Bgk (L36A) | IC50 |
6.4 nM
|
[126] |
| Toxin Info Potassium channel toxin ShK (F27[Cha]) | IC50 |
7 nM
|
[270] |
| Toxin Info Potassium channel toxin Bgk (R3A) | IC50 |
7.7 nM
|
[126] |
| Toxin Info Potassium channel toxin ShK (K18A) | IC50 |
8 nM
|
[203] |
| Toxin Info Potassium channel toxin ShK (Y23[Apa]) | IC50 |
8 nM
|
[203] |
| Toxin Info Potassium channel toxin ShK (Y23F) | IC50 |
8 nM
|
[203] |
| Toxin Info (M21[Nle])ShK | IC50 |
8 nM
|
[203] |
| Toxin Info Potassium channel toxin alpha-KTx 8.7 | IC50 |
8.5 nM
|
[115] |
| Toxin Info Potassium channel toxin alpha-KTx 8.7 | IC50 |
8.5 nM
|
[115] |
| Toxin Info Potassium channel toxin ShK (1[Ac]) | IC50 |
10 nM
|
[270] |
| Toxin Info Potassium channel toxin ShK (F15W) | IC50 |
10 nM
|
[203] |
| Toxin Info Potassium channel toxin ShK (Y23[Nph]) | IC50 |
10 nM
|
[203] |
| Toxin Info Kunitz-type kappaPI-theraphotoxin-Hs1a | IC50 |
11.6 nM
|
[278- 282] |
| Toxin Info PI-stichotoxin-Hcr2g | IC50 |
12.6 nM
|
[174] |
| Toxin Info PI-stichotoxin-Hcr2g | IC50 |
12.6 nM
|
[174- 284] |
| Toxin Info Potassium channel toxin alpha-KTx 6.15 | IC50 |
13 nM
|
[285] |
| Toxin Info Potassium channel toxin alpha-KTx 6.15 | IC50 |
13 nM
|
[285] |
| Toxin Info Potassium channel toxin ShK (R24A) | IC50 |
13 nM
|
[203] |
| Toxin Info Kappa-actitoxin-Bcs3b | IC50 |
14.42 nM
|
[286] |
| Toxin Info Kappa-actitoxin-Bcs3b | IC50 |
14.42 nM
|
[286] |
| Toxin Info Potassium channel toxin ShK (R1S) | IC50 |
15 nM
|
[203] |
| Toxin Info Potassium channel toxin alpha-KTx 3.4 | IC50 |
15 nM
|
[19- 39] |
| Toxin Info Potassium channel toxin alpha-KTx 6.15 | IC50 |
16 nM
|
[285] |
| Toxin Info Potassium channel toxin ShK (K22[Orn]) | IC50 |
17 nM
|
[203] |
| Toxin Info Potassium channel toxin ShK (R11Q) | IC50 |
18 nM
|
[203] |
| Toxin Info Potassium channel toxin Bgk (H13A) | IC50 |
20 nM
|
[126] |
| Toxin Info Potassium channel toxin ShK (F15A,L25A) | IC50 |
21 nM
|
[270] |
| Toxin Info Kappa-actitoxin-Aeq4a | IC50 |
22 nM
|
[206- 287] |
| Toxin Info Potassium channel toxin ShK (H19K) | IC50 |
26 nM
|
[270] |
| Toxin Info Potassium channel toxin ShK (Q16E) | IC50 |
28 nM
|
[270] |
| Toxin Info Potassium channel toxin Bgk (S23A) | IC50 |
30 nM
|
[126] |
| Toxin Info Potassium channel toxin TsTXK-beta | IC50 |
30 nM
|
[122- 293] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | IC50 |
36 nM
|
[8- 12] |
| Toxin Info Potassium channel toxin alpha-KTx 7.2 | IC50 |
42 nM
|
[276] |
| Toxin Info Kappa-scoloptoxin(03)-Ssm1a | IC50 |
44.2 nM
|
[147] |
| Toxin Info Potassium channel toxin alpha-KTx 6.2 | IC50 |
45 nM
|
[20- 267] |
| Toxin Info Potassium channel toxin alpha-KTx 12.2 | IC50 |
46 nM
|
[296], [297] |
| Toxin Info Potassium channel toxin alpha-KTx 12.1 | IC50 |
46 nM
|
[140- 304] |
| Toxin Info Discrepin (V6K) | IC50 |
51 nM
|
[305] |
| Toxin Info Potassium channel toxin Bgk (T33A) | IC50 |
70 nM
|
[126] |
| Toxin Info Potassium channel toxin alpha-KTx 3.7 | IC50 |
72 nM
|
[9- 308] |
| Toxin Info Hgscplike1 | IC50 |
88 nM
|
[309] |
| Toxin Info Potassium channel toxin ShK (Y23[Cha]) | IC50 |
88 nM
|
[270] |
| Toxin Info Potassium channel toxin alpha-KTx 3.18 | IC50 |
90 ± 2 nM
|
[115] |
| Toxin Info Potassium channel toxin alpha-KTx 3.18 | IC50 |
90.3 nM
|
[115] |
| Toxin Info Kappa-actitoxin-Aer3a | IC50 |
91 nM
|
[206- 310] |
| Toxin Info Potassium channel toxin Tst-beta-KTx | IC50 |
96 nM
|
[311], [312], [309] |
| Toxin Info Discrepin (D20K) | IC50 |
96 nM
|
[305] |
| Toxin Info Potassium channel toxin ShK (C3[Abu],C35[Abu]) | IC50 |
96.8 nM
|
[212] |
| Toxin Info Potassium channel toxin Bgk (Y26A) | IC50 |
100 nM
|
[126] |
| Toxin Info Potassium channel toxin MeuTXK-beta-1 | IC50 |
100 nM
|
[313] |
| Toxin Info Potassium channel toxin alpha-KTx 6.1 | IC50 |
100 nM
|
[132- 318] |
| Toxin Info Potassium channel toxin alpha-KTx 1.17 | IC50 |
130 nM
|
[319] |
| Toxin Info Potassium channel toxin alpha-KTx 1.17 | IC50 |
130 - 135 nM
|
[115- 319] |
| Toxin Info Potassium channel toxin alpha-KTx 1.17 | IC50 |
134.8 nM
|
[115] |
| Toxin Info PI-stichotoxin-Hcr2f | IC50 |
142.5 nM
|
[174] |
| Toxin Info PI-stichotoxin-Hcr2f | IC50 |
142.6 nM
|
[174- 284] |
| Toxin Info Potassium channel toxin alpha-KTx 9.5 | IC50 |
145 nM
|
[320] |
| Toxin Info Potassium channel toxin Bgk (F6A) | IC50 |
167 nM
|
[126] |
| Toxin Info Hge-scorpine | IC50 |
185 nM
|
[309- 322] |
| Toxin Info Discrepin (I19R,D20K) | IC50 |
235 nM
|
[305] |
| Toxin Info Discrepin (T35V) | IC50 |
261 nM
|
[305] |
| Toxin Info Potassium channel toxin ShK (R11E) | IC50 |
308 nM
|
[270] |
| Toxin Info Discrepin (I19R) | IC50 |
335 nM
|
[305] |
| Toxin Info Kappa-actitoxin-Ate1a | IC50 |
353 nM
|
[323] |
| Toxin Info Crotamine | IC50 |
369 nM
|
[324- 340] |
| Toxin Info Potassium channel toxin ShK (C17[Abu],C32[Abu]) | IC50 |
370 nM
|
[212] |
| Toxin Info Kappa-actitoxin-Bcs3a | IC50 |
405 nM
|
[286] |
| Toxin Info Kappa-actitoxin-Bcs3a | IC50 |
405 nM
|
[286] |
| Toxin Info Potassium channel toxin gamma-KTx 3.1 | IC50 |
418 nM
|
[341], [342] |
| Toxin Info Potassium channel toxin alpha-KTx 8.2 | IC50 |
467 nM
|
[15- 190] |
| Toxin Info Potassium channel toxin alpha-KTx 3.10 | IC50 |
550 nM
|
[130- 343] |
| Toxin Info Kappa-scoloptoxin(07)-Ssm2a | IC50 |
570 nM
|
[147] |
| Toxin Info Potassium channel toxin kappa-KTx 5.1 | IC50 |
578.5 nM
|
[9- 344] |
| Toxin Info KappaPI-stichotoxin-Shd2a | IC50 |
650 nM
|
[206- 345] |
| Toxin Info Potassium channel toxin AbeTx1 | IC50 |
672 nM
|
[346] |
| Toxin Info Toxin MeKTx11-3 (V9G) | IC50 |
740 nM
|
[319] |
| Toxin Info Discrepin | IC50 |
764 nM
|
[305] |
| Toxin Info Potassium channel toxin alpha-KTx 1.16 | IC50 |
783.2 nM
|
[115] |
| Toxin Info Potassium channel toxin alpha-KTx 1.16 | IC50 |
0.780 - 2.110 μM
|
[115- 319] |
| Toxin Info Toxin MeKTx11-3 (S37P) | IC50 |
1.38 μM
|
[319] |
| Toxin Info Kappa-conotoxin ViTx | IC50 |
1.59 μM
|
[347], [348] |
| Toxin Info HelaTx1_A1S | IC50 |
1.9366 μM
|
[344] |
| Toxin Info Potassium channel toxin alpha-KTx 9.1 | IC50 |
1.95 μM
|
[15- 350] |
| Toxin Info Potassium channel toxin AbeTx1 (A) | IC50 |
1.972 μM
|
[346] |
| Toxin Info Potassium channel toxin ShK (C12[Abu],C28[Abu]) | IC50 |
2.107 μM
|
[212] |
| Toxin Info Potassium channel toxin alpha-KTx 1.16 | IC50 |
2.11 μM
|
[319] |
| Toxin Info Potassium channel toxin ShK (K22[Nle]) | IC50 |
2.5 μM
|
[203] |
| Toxin Info Potassium channel toxin ShK (K22A) | IC50 |
2.5 μM
|
[203] |
| Toxin Info HelaTx1 (S) | IC50 |
3.1116 μM
|
[344] |
| Toxin Info Pi-phymatoxin-Pcf1a | IC50 |
3.5 μM
|
[351] |
| Toxin Info Kappa-conotoxin RIIIJ | IC50 |
4 μM
|
[352] |
| Toxin Info HelaTx1 (11A) | IC50 |
4.1108 μM
|
[344] |
| Toxin Info Potassium channel toxin AbeTx1 (R,K12A) | IC50 |
4.548 μM
|
[346] |
| Toxin Info Potassium channel toxin ShK (K22[Hmc]) | IC50 |
5 μM
|
[203] |
| Toxin Info Potassium channel toxin ShK (K22R) | IC50 |
5 μM
|
[203] |
| Toxin Info Potassium channel toxin alpha-KTx 9.2 | IC50 |
5.48 μM
|
[187- 349] |
| Toxin Info HelaTx1 (S,11A) | IC50 |
6.0939 μM
|
[344] |
| Toxin Info Potassium channel toxin ShK (K22E) | IC50 |
7.26 μM
|
[270] |
| Toxin Info Potassium channel toxin AbeTx1 (R,R8A) | IC50 |
8.503 μM
|
[346] |
| Toxin Info Kunitz-type serine protease inhibitor HCRG21 (S5L) | IC50 |
15.6 μM
|
[174] |
| Toxin Info Potassium channel toxin AbeTx1 (R,K6A) | IC50 |
17.759 μM
|
[346] |
| Toxin Info Potassium channel toxin AbeTx1 (R,R10A) | IC50 |
21.53 μM
|
[346] |
| Toxin Info Potassium channel toxin AbeTx1 (R,K2A) | IC50 |
27.532 μM
|
[346] |
| Toxin Info Kappa-hefutoxin 3 (K20A) | IC50 |
110.7 μM
|
[120] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
