General Information of This Target
Target ID
BTDT00046
Target Name
Potassium voltage-gated channel subfamily A member 1 (Kcna1)
Target Bioclass
Transporter and channel
Uniprot ID
P10499
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
Kcna1
Gene ID
24520
Synonym
RBKI; RCK1; Voltage-gated potassium channel subunit Kv1.1
Sequence
MTVMSGENADEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY
ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS
IVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRF
FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF
RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP
DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE
GEEQAQLLHVSSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTA
TDQNCVNKSKLLTDV

    Click to Show/Hide
Family
the potassium channel family
Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney. Contributes to the regulation of the membrane potential and nerve signaling, and prevents neuronal hyperexcitability. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA1 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heterotetrameric channel formed by KCNA1 and KCNA4 shows rapid inactivation. Regulates neuronal excitability in hippocampus, especially in mossy fibers and medial perforant path axons, preventing neuronal hyperexcitability. Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA) release. Plays a role in regulating the generation of action potentials and preventing hyperexcitability in myelinated axons of the vagus nerve, and thereby contributes to the regulation of heart contraction. Required for normal neuromuscular responses. Regulates the frequency of neuronal action potential firing in response to mechanical stimuli, and plays a role in the perception of pain caused by mechanical stimuli, but does not play a role in the perception of pain due to heat stimuli. Required for normal responses to auditory stimuli and precise location of sound sources, but not for sound perception. The use of toxins that block specific channels suggest that it contributes to the regulation of the axonal release of the neurotransmitter dopamine. Required for normal postnatal brain development and normal proliferation of neuronal precursor cells in the brain. Plays a role in the reabsorption of Mg(2+) in the distal convoluted tubules in the kidney and in magnesium ion homeostasis, probably via its effect on the membrane potential.

    Click to Show/Hide
Taxonomy ID
10116
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Rodentia
Family: Muridae
Genus: Rattus
Species: Rattus norvegicus
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Potassium channel toxin Bgk (K25[Dab]) . . [1]
 Toxin Info    Potassium channel toxin Bgk (K25[Dap]) . . [1]
 Toxin Info    Potassium channel toxin Bgk (K25[Nle]) . . [1]
 Toxin Info    Bgk (W5Y,Y26F) Dissociation constant
5 pM
[2]
 Toxin Info    Potassium channel toxin Bgk (W5Y,F6A,Y26F) Dissociation constant
0.071 nM
[2]
 Toxin Info    Kunitz-type serine protease inhibitor homolog delta-dendrotoxin Dissociation constant
0.1 nM
[3], [4]
 Toxin Info    Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin Dissociation constant
1.1 nM
[3- 7]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 Dissociation constant
1.1 nM
[8- 12]
 Toxin Info    Potassium channel toxin Bgk (K25[Orn]) Dissociation constant
20 nM
[1]
 Toxin Info    Potassium channel toxin Bgk (K25A,Y26A) Dissociation constant
157 nM
[1]
 Toxin Info    Potassium channel toxin alpha-KTx 11.2 Dissociation constant
1 μM
[13], [14]
 Toxin Info    Potassium channel toxin alpha-KTx 11.3 Dissociation constant
1 μM
[14]
 Toxin Info    PBTx1 (T24F,V26K) Dissociation constant
1.1 μM
[14]
 Toxin Info    Potassium channel toxin alpha-KTx 11.1 Dissociation constant
21 μM
[13], [14], [15]
 Toxin Info    Potassium channel toxin alpha-KTx 1.10 Dissociation constant
79 μM
[16], [17], [18]
 Toxin Info    Potassium channel toxin alpha-KTx 3.2 Inhibition constant
0.044 nM
[8- 21]
 Toxin Info    Potassium channel toxin alpha-KTx 10.2 Inhibition constant
0.087 nM
[22]
 Toxin Info    Potassium channel toxin alpha-KTx 2.7 Inhibition constant
0.1 nM
[23]
 Toxin Info    Potassium channel toxin alpha-KTx 2.3 Inhibition constant
0.1 nM
[23], [24]
 Toxin Info    Potassium channel toxin alpha-KTx 10.1 Inhibition constant
0.109 nM
[22], [25]
 Toxin Info    Venom basic protease inhibitor K (A27K) Inhibition constant
0.14 nM
[26]
 Toxin Info    Venom basic protease inhibitor K (R52A) Inhibition constant
0.18 nM
[26]
 Toxin Info    Venom basic protease inhibitor 1 homolog (N12D,K28A,K29A,K30G) Inhibition constant
0.22 nM
[27]
 Toxin Info    Potassium channel toxin alpha-KTx 1.2 Inhibition constant
0.25 nM
[28], [29], [30]
 Toxin Info    Kunitz-type serine protease inhibitor homolog dendrotoxin K Inhibition constant
0.29 nM
[26- 36]
 Toxin Info    Venom basic protease inhibitor K (R53A) Inhibition constant
0.57 nM
[26]
 Toxin Info    Venom basic protease inhibitor K (K17A) Inhibition constant
0.74 nM
[35]
 Toxin Info    Venom basic protease inhibitor K (K15Y) Inhibition constant
0.79 nM
[35]
 Toxin Info    Venom basic protease inhibitor K (R16A) Inhibition constant
0.8 nM
[35]
 Toxin Info    Venom basic protease inhibitor K (K28A) Inhibition constant
0.84 nM
[26]
 Toxin Info    Venom basic protease inhibitor K (K24A) Inhibition constant
0.94 nM
[26]
 Toxin Info    Venom basic protease inhibitor 1 homolog (N12D,K28A,K29A,K30G) Inhibition constant
1.37 nM
[27]
 Toxin Info    Venom basic protease inhibitor 1 homolog (H10A) Inhibition constant
1.6 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (N12D) Inhibition constant
2.13 nM
[27]
 Toxin Info    Venom basic protease inhibitor 1 homolog (K19A) Inhibition constant
2.3 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (K48A) Inhibition constant
2.8 nM
[37]
 Toxin Info    Venom basic protease inhibitor K (W25A) Inhibition constant
2.8 nM
[26]
 Toxin Info    Venom basic protease inhibitor 1 homolog (Q27A) Inhibition constant
2.9 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (R11A) Inhibition constant
3 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (D18A) Inhibition constant
3.4 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (I58A) Inhibition constant
3.45 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (E51A) Inhibition constant
3.65 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (Q31A) Inhibition constant
3.65 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (Y17A) Inhibition constant
3.7 nM
[37]
 Toxin Info    Venom basic protease inhibitor K (K6A) Inhibition constant
3.9 nM
[26]
 Toxin Info    Venom basic protease inhibitor 1 homolog (R55A) Inhibition constant
4 nM
[37]
 Toxin Info    Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin Inhibition constant
4 nM
[3- 7]
 Toxin Info    Venom basic protease inhibitor 1 homolog (R15A) Inhibition constant
4.6 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (N12D) Inhibition constant
4.76 nM
[27]
 Toxin Info    Venom basic protease inhibitor 1 homolog (D36A) Inhibition constant
4.85 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (E33A) Inhibition constant
5.3 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (R54A) Inhibition constant
5.4 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (S44A) Inhibition constant
6.7 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (R34A) Inhibition constant
7.1 nM
[37]
 Toxin Info    Venom basic protease inhibitor K (W25Q,A27K) Inhibition constant
9.7 nM
[35]
 Toxin Info    Venom basic protease inhibitor 1 homolog (P2A) Inhibition constant
10.6 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (S38A) Inhibition constant
23.5 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (R3A) Inhibition constant
28.5 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (R4A) Inhibition constant
38 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (L6A) Inhibition constant
43.4 nM
[37]
 Toxin Info    Potassium channel toxin alpha-KTx 16.5 Inhibition constant
50 nM
[30]
 Toxin Info    Venom basic protease inhibitor K (K26A) Inhibition constant
51 nM
[26]
 Toxin Info    Venom basic protease inhibitor K (K17A,K26A) Inhibition constant
88 nM
[35]
 Toxin Info    Potassium channel toxin alpha-KTx 2.4 Inhibition constant
100 nM
[38]
 Toxin Info    Venom basic protease inhibitor 1 homolog (I8A) Inhibition constant
118 nM
[37]
 Toxin Info    Potassium channel toxin alpha-KTx 3.4 Inhibition constant
136 nM
[19- 39]
 Toxin Info    Venom basic protease inhibitor K (P13Q,K26A,K28A) Inhibition constant
140 nM
[35]
 Toxin Info    Venom basic protease inhibitor K (K3A) Inhibition constant
324 nM
[26]
 Toxin Info    Venom basic protease inhibitor 1 homolog (K5[Orn]) Inhibition constant
471 nM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (R46A) Inhibition constant
562 nM
[37]
 Toxin Info    Potassium channel toxin alpha-KTx 1.1 Inhibition constant
1.5 μM
[8- 53]
 Toxin Info    Venom basic protease inhibitor 1 homolog (L9A) Inhibition constant
4.16 μM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (K5[Nle]) Inhibition constant
5.7 μM
[37]
 Toxin Info    Venom basic protease inhibitor 1 homolog (K5A) Inhibition constant
5.8 μM
[37]
 Toxin Info    N.vectensis toxin 4 Effect . [54]
 Toxin Info    N.vectensis toxin 5 Effect . [54]
 Toxin Info    Potassium channel toxin Aek Inhibition rate . [55]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 Inhibition rate . [56]
 Toxin Info    KTX-1 (G7L,S8P,P9Q,L12I,R28K,H31R) Inhibition rate . [8]
 Toxin Info    MTX (G18G[Abu],G33G[Abu]) Inhibition rate . [57]
 Toxin Info    HelaTx1 (A1S) Inhibition rate . [58]
 Toxin Info    HelaTx1 (G8A) Inhibition rate . [58]
 Toxin Info    Potassium channel toxin alpha-KTx 3.4 Inhibition rate . [56]
 Toxin Info    HelaTx1 (K13A) Inhibition rate . [58]
 Toxin Info    HelaTx1 (K14A) Inhibition rate . [58]
 Toxin Info    HelaTx1 (K18A) Inhibition rate . [58]
 Toxin Info    HelaTx1 (R10A) Inhibition rate . [58]
 Toxin Info    HelaTx1 (R11A) Inhibition rate . [58]
 Toxin Info    Mu-conotoxin CnIIIC Inhibition rate . [59], [60], [61]
 Toxin Info    Defensin-like protein 1 Inhibition rate . [62]
 Toxin Info    Kappa-conotoxin PVIIA Inhibition rate . [63- 74]
 Toxin Info    Mesomartoxin Inhibition rate . [75]
 Toxin Info    Mu-conotoxin GIIIA Inhibition rate . [76- 88]
 Toxin Info    Potassium channel toxin alpha-KTx 13.2 Inhibition rate . [89]
 Toxin Info    Toxin PhcrTx2 Inhibition rate . [90]
 Toxin Info    Apamin Inhibition rate . [91- 108]
 Toxin Info    Potassium channel toxin alpha-KTx 20.1 Inhibition rate . [109]
 Toxin Info    Potassium channel toxin alpha-KTx 3.12 Inhibition rate . [110]
 Toxin Info    Potassium channel toxin alpha-KTx 15.2 Inhibition rate . [111]
 Toxin Info    Potassium channel toxin alpha-KTx 19.1 Inhibition rate . [112]
 Toxin Info    Potassium channel toxin alpha-KTx 8.5 Inhibition rate . [113]
 Toxin Info    Potassium channel toxin alpha-KTx 8.6 Inhibition rate . [114], [115]
 Toxin Info    Potassium channel toxin alpha-KTx 8.8 Inhibition rate . [116]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.1 Inhibition rate . [117]
 Toxin Info    Potassium channel toxin alpha-KTx 3.11 Inhibition rate . [118]
 Toxin Info    Potassium channel toxin alpha-KTx 6.4 Inhibition rate . [119]
 Toxin Info    Potassium channel toxin kappa-KTx 1.3 Inhibition rate . [120]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.2 Inhibition rate . [117]
 Toxin Info    Potassium channel toxin kappa-KTx 2.5 Inhibition rate . [121]
 Toxin Info    Potassium channel toxin TsTXK-beta Inhibition rate . [122]
 Toxin Info    U-actitoxin-Oulsp1 Inhibition rate . [123]
 Toxin Info    U-actitoxin-Oulsp1 Inhibition rate . [124]
 Toxin Info    Potassium channel toxin alpha-KTx 16.4 Inhibition rate . [125]
 Toxin Info    HelaTx1 Inhibition rate . [58]
 Toxin Info    Potassium channel toxin Bgk (K25A) Inhibition rate . [126]
 Toxin Info    Potassium channel toxin kappa-KTx 1.2 Inhibition rate . [120- 130]
 Toxin Info    Neurotoxin lambda-MeuTx Inhibition rate . [131]
 Toxin Info    Potassium channel toxin alpha-KTx 6.1 Inhibition rate . [132]
 Toxin Info    MTX (S2V,C3I,T4G,G5Q,S6R,K7C,D8T,C9G,Y10S,A11K,P12D,R14Y,K15A,Q16P,T17C,G18R,C19K,P20Q,N21T,A22G,K23C,C24P,I25N,N26A,S28C,C29I,K30N,C31K,Y32S,G33C,C34K) Inhibition rate . [133]
 Toxin Info    Potassium channel toxin alpha-KTx 16.8 Inhibition rate . [134]
 Toxin Info    Potassium channel toxin alpha-KTx 16.9 Inhibition rate . [134]
 Toxin Info    Potassium channel toxin alpha-KTx 3.6 Inhibition rate
>0 %
[46- 138]
 Toxin Info    Calcium channel toxin-like peptide-1 Inhibition rate
8 %
[131]
 Toxin Info    Potassium channel toxin kappa-KTx 2.2 Inhibition rate
8 %
[139]
 Toxin Info    Potassium channel toxin alpha-KTx 12.2 Inhibition rate
9 %
[140]
 Toxin Info    Potassium channel toxin alpha-KTx 12.1 Inhibition rate
9 %
[140]
 Toxin Info    Pi-stichotoxin-Hcr5b Inhibition rate
10 %
[141]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 Inhibition rate
10 %
[142]
 Toxin Info    Kappa-hefutoxin 3 Inhibition rate
10.7 %
[120]
 Toxin Info    Potassium channel toxin kappa-KTx 2.2 Inhibition rate
17 %
[139]
 Toxin Info    Kunitz-type conkunitzin-S1 Inhibition rate
20 %
[143], [144], [145]
 Toxin Info    Kappa-scoloptoxin(15)-Ssd2a Inhibition rate
20 %
[146]
 Toxin Info    Kappa-scoloptoxin(11)-Ssm3a Inhibition rate
25 %
[147]
 Toxin Info    Mu-conotoxin SIIIA Inhibition rate
27 %
[59- 172]
 Toxin Info    Potassium channel toxin alpha-KTx 3.18 Inhibition rate
30 %
[115]
 Toxin Info    Potassium channel toxin alpha-KTx 31.1 Inhibition rate
32 %
[173]
 Toxin Info    Potassium channel toxin alpha-KTx 31.1 Inhibition rate
32 %
[173]
 Toxin Info    Kunitz-type serine protease inhibitor HCRG21 Inhibition rate
33 %
[174]
 Toxin Info    Potassium channel toxin kappa-KTx 2.3 Inhibition rate
33 %
[139]
 Toxin Info    Potassium channel toxin alpha-KTx 8.6 Inhibition rate
35 %
[114]
 Toxin Info    Potassium channel toxin MeuTXKalpha3 Inhibition rate
35 %
[175]
 Toxin Info    Potassium channel toxin alpha-KTx (N30P) Inhibition rate
38 %
[175]
 Toxin Info    Kappa-actitoxin-Bcs4a Inhibition rate
54 %
[176]
 Toxin Info    Basic phospholipase A2 homolog Gln49-PLA2 Inhibition rate
54.25 %
[177], [178], [179]
 Toxin Info    Acidic phospholipase A2 natratoxin Inhibition rate
57 %
[180]
 Toxin Info    Mu-conotoxin PIIIA Inhibition rate
73 %
[59- 184]
 Toxin Info    Mambaquaretin-7 Inhibition rate
80 %
[185]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 Inhibition rate
85 %
[140]
 Toxin Info    Potassium channel toxin alpha-KTx 19.2 Inhibition rate
100 %
[186]
 Toxin Info    Potassium channel toxin alpha-KTx 3.6 Inhibition rate
100 %
[137]
 Toxin Info    Potassium channel toxin alpha-KTx 8.2 Inhibition rate
100 %
[15- 190]
 Toxin Info    Kunitz-type serine protease inhibitor homolog beta-bungarotoxin B2 chain Effective concentration 50
3 nM
[191]
 Toxin Info    Potassium channel toxin kappa-KTx 5.1 Effective concentration 50
9.9 μM
[192]
 Toxin Info    HgTX1 (A19[Cme]) IC50
0.6 pM
[193]
 Toxin Info    Potassium channel toxin alpha-KTx 6.3 IC50
1 pM
[18- 200]
 Toxin Info    HgTX1 (A19C) IC50
2 pM
[193]
 Toxin Info    HgTX1 (A19C) IC50
2 pM
[193]
 Toxin Info    HgTX1 (A19C) IC50
3 pM
[193]
 Toxin Info    HgTX1 (A19C) IC50
4 pM
[193]
 Toxin Info    HgTX1 (A19C) IC50
5 pM
[193]
 Toxin Info    HgTX1 (A19C) IC50
6.4 pM
[193]
 Toxin Info    HgTX1 (A19C) IC50
7 pM
[193]
 Toxin Info    Potassium channel toxin alpha-KTx 3.13 IC50
203.15 pM
[137]
 Toxin Info    HgTX1 (A19C) IC50
0.011 nM
[193]
 Toxin Info    Kappa-stichotoxin-She3a IC50
0.02 nM
[201- 216]
 Toxin Info    Potassium channel toxin alpha-KTx 3.5 IC50
0.05 nM
[130]
 Toxin Info    Potassium channel toxin alpha-KTx 3.9 IC50
0.05 nM
[217]
 Toxin Info    Potassium channel toxin alpha-KTx 1.5 IC50
0.09 nM
[130- 238]
 Toxin Info    Potassium channel toxin alpha-KTx 3.17 IC50
0.1 nM
[134]
 Toxin Info    MeuKTx (G11R,G30R,D33H) IC50
0.11 nM
[239- 258]
 Toxin Info    Potassium channel toxin alpha-KTx 1.6 IC50
0.12 nM
[18- 259]
 Toxin Info    Potassium channel toxin alpha-KTx 6.2 IC50
0.2 nM
[20- 267]
 Toxin Info    Potassium channel toxin alpha-KTx 3.6 IC50
0.2 nM
[46- 237]
 Toxin Info    Potassium channel toxin alpha-KTx 3.13 IC50
0.203 nM
[137]
 Toxin Info    KappaPI-actitoxin-Ael3a IC50
0.9 nM
[206- 268]
 Toxin Info    KappaPI-actitoxin-Ael3a IC50
0.9 nM
[206- 268]
 Toxin Info    Potassium channel toxin Bgk (E8A) IC50
1.5 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (Q24A) IC50
1.5 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (T9A) IC50
1.6 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (V1A) IC50
1.6 nM
[126]
 Toxin Info    Potassium channel toxin alpha-KTx 3.19 IC50
1.9 nM
[115]
 Toxin Info    Potassium channel toxin alpha-KTx 3.19 IC50
1.9 nM
[115- 269]
 Toxin Info    Potassium channel toxin alpha-KTx 3.2 IC50
2 nM
[8- 21]
 Toxin Info    Potassium channel toxin ShK (I4A,F15A,L25A) IC50
2 nM
[270]
 Toxin Info    Kunitz-type serine protease inhibitor homolog dendrotoxin K IC50
2.5 nM
[26- 36]
 Toxin Info    Potassium channel toxin Bgk (L17A) IC50
2.5 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (T22A) IC50
2.5 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (W5A) IC50
2.7 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (S16A) IC50
2.8 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (E35A) IC50
3 nM
[126]
 Toxin Info    Kappa-stichotoxin-Hmg1a IC50
3.2 nM
[206- 272]
 Toxin Info    Potassium channel toxin Bgk (R12A) IC50
3.6 nM
[126]
 Toxin Info    Kappa-actitoxin-Bgr1a IC50
3.6 nM
[1- 275]
 Toxin Info    Potassium channel toxin Bgk (N29A) IC50
4.2 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (R21A) IC50
4.6 nM
[126]
 Toxin Info    Potassium channel toxin ShK (I4A,F15A) IC50
5 nM
[270]
 Toxin Info    Potassium channel toxin Bgk (R27A) IC50
5.1 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (K15A) IC50
5.5 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (K32A) IC50
5.5 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (K7A) IC50
5.7 nM
[126]
 Toxin Info    Potassium channel toxin ShK (F15A) IC50
6 nM
[203]
 Toxin Info    Potassium channel toxin ShK (K9Q) IC50
6 nM
[203]
 Toxin Info    Potassium channel toxin alpha-KTx 7.1 IC50
6 nM
[276], [277]
 Toxin Info    Potassium channel toxin Bgk (N19A) IC50
6.3 nM
[126]
 Toxin Info    Potassium channel toxin Bgk (L36A) IC50
6.4 nM
[126]
 Toxin Info    Potassium channel toxin ShK (F27[Cha]) IC50
7 nM
[270]
 Toxin Info    Potassium channel toxin Bgk (R3A) IC50
7.7 nM
[126]
 Toxin Info    Potassium channel toxin ShK (K18A) IC50
8 nM
[203]
 Toxin Info    Potassium channel toxin ShK (Y23[Apa]) IC50
8 nM
[203]
 Toxin Info    Potassium channel toxin ShK (Y23F) IC50
8 nM
[203]
 Toxin Info    (M21[Nle])ShK IC50
8 nM
[203]
 Toxin Info    Potassium channel toxin alpha-KTx 8.7 IC50
8.5 nM
[115]
 Toxin Info    Potassium channel toxin alpha-KTx 8.7 IC50
8.5 nM
[115]
 Toxin Info    Potassium channel toxin ShK (1[Ac]) IC50
10 nM
[270]
 Toxin Info    Potassium channel toxin ShK (F15W) IC50
10 nM
[203]
 Toxin Info    Potassium channel toxin ShK (Y23[Nph]) IC50
10 nM
[203]
 Toxin Info    Kunitz-type kappaPI-theraphotoxin-Hs1a IC50
11.6 nM
[278- 282]
 Toxin Info    PI-stichotoxin-Hcr2g IC50
12.6 nM
[174]
 Toxin Info    PI-stichotoxin-Hcr2g IC50
12.6 nM
[174- 284]
 Toxin Info    Potassium channel toxin alpha-KTx 6.15 IC50
13 nM
[285]
 Toxin Info    Potassium channel toxin alpha-KTx 6.15 IC50
13 nM
[285]
 Toxin Info    Potassium channel toxin ShK (R24A) IC50
13 nM
[203]
 Toxin Info    Kappa-actitoxin-Bcs3b IC50
14.42 nM
[286]
 Toxin Info    Kappa-actitoxin-Bcs3b IC50
14.42 nM
[286]
 Toxin Info    Potassium channel toxin ShK (R1S) IC50
15 nM
[203]
 Toxin Info    Potassium channel toxin alpha-KTx 3.4 IC50
15 nM
[19- 39]
 Toxin Info    Potassium channel toxin alpha-KTx 6.15 IC50
16 nM
[285]
 Toxin Info    Potassium channel toxin ShK (K22[Orn]) IC50
17 nM
[203]
 Toxin Info    Potassium channel toxin ShK (R11Q) IC50
18 nM
[203]
 Toxin Info    Potassium channel toxin Bgk (H13A) IC50
20 nM
[126]
 Toxin Info    Potassium channel toxin ShK (F15A,L25A) IC50
21 nM
[270]
 Toxin Info    Kappa-actitoxin-Aeq4a IC50
22 nM
[206- 287]
 Toxin Info    Potassium channel toxin ShK (H19K) IC50
26 nM
[270]
 Toxin Info    Potassium channel toxin ShK (Q16E) IC50
28 nM
[270]
 Toxin Info    Potassium channel toxin Bgk (S23A) IC50
30 nM
[126]
 Toxin Info    Potassium channel toxin TsTXK-beta IC50
30 nM
[122- 293]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 IC50
36 nM
[8- 12]
 Toxin Info    Potassium channel toxin alpha-KTx 7.2 IC50
42 nM
[276]
 Toxin Info    Kappa-scoloptoxin(03)-Ssm1a IC50
44.2 nM
[147]
 Toxin Info    Potassium channel toxin alpha-KTx 6.2 IC50
45 nM
[20- 267]
 Toxin Info    Potassium channel toxin alpha-KTx 12.2 IC50
46 nM
[296], [297]
 Toxin Info    Potassium channel toxin alpha-KTx 12.1 IC50
46 nM
[140- 304]
 Toxin Info    Discrepin (V6K) IC50
51 nM
[305]
 Toxin Info    Potassium channel toxin Bgk (T33A) IC50
70 nM
[126]
 Toxin Info    Potassium channel toxin alpha-KTx 3.7 IC50
72 nM
[9- 308]
 Toxin Info    Hgscplike1 IC50
88 nM
[309]
 Toxin Info    Potassium channel toxin ShK (Y23[Cha]) IC50
88 nM
[270]
 Toxin Info    Potassium channel toxin alpha-KTx 3.18 IC50
90 ± 2 nM
[115]
 Toxin Info    Potassium channel toxin alpha-KTx 3.18 IC50
90.3 nM
[115]
 Toxin Info    Kappa-actitoxin-Aer3a IC50
91 nM
[206- 310]
 Toxin Info    Potassium channel toxin Tst-beta-KTx IC50
96 nM
[311], [312], [309]
 Toxin Info    Discrepin (D20K) IC50
96 nM
[305]
 Toxin Info    Potassium channel toxin ShK (C3[Abu],C35[Abu]) IC50
96.8 nM
[212]
 Toxin Info    Potassium channel toxin Bgk (Y26A) IC50
100 nM
[126]
 Toxin Info    Potassium channel toxin MeuTXK-beta-1 IC50
100 nM
[313]
 Toxin Info    Potassium channel toxin alpha-KTx 6.1 IC50
100 nM
[132- 318]
 Toxin Info    Potassium channel toxin alpha-KTx 1.17 IC50
130 nM
[319]
 Toxin Info    Potassium channel toxin alpha-KTx 1.17 IC50
130 - 135 nM
[115- 319]
 Toxin Info    Potassium channel toxin alpha-KTx 1.17 IC50
134.8 nM
[115]
 Toxin Info    PI-stichotoxin-Hcr2f IC50
142.5 nM
[174]
 Toxin Info    PI-stichotoxin-Hcr2f IC50
142.6 nM
[174- 284]
 Toxin Info    Potassium channel toxin alpha-KTx 9.5 IC50
145 nM
[320]
 Toxin Info    Potassium channel toxin Bgk (F6A) IC50
167 nM
[126]
 Toxin Info    Hge-scorpine IC50
185 nM
[309- 322]
 Toxin Info    Discrepin (I19R,D20K) IC50
235 nM
[305]
 Toxin Info    Discrepin (T35V) IC50
261 nM
[305]
 Toxin Info    Potassium channel toxin ShK (R11E) IC50
308 nM
[270]
 Toxin Info    Discrepin (I19R) IC50
335 nM
[305]
 Toxin Info    Kappa-actitoxin-Ate1a IC50
353 nM
[323]
 Toxin Info    Crotamine IC50
369 nM
[324- 340]
 Toxin Info    Potassium channel toxin ShK (C17[Abu],C32[Abu]) IC50
370 nM
[212]
 Toxin Info    Kappa-actitoxin-Bcs3a IC50
405 nM
[286]
 Toxin Info    Kappa-actitoxin-Bcs3a IC50
405 nM
[286]
 Toxin Info    Potassium channel toxin gamma-KTx 3.1 IC50
418 nM
[341], [342]
 Toxin Info    Potassium channel toxin alpha-KTx 8.2 IC50
467 nM
[15- 190]
 Toxin Info    Potassium channel toxin alpha-KTx 3.10 IC50
550 nM
[130- 343]
 Toxin Info    Kappa-scoloptoxin(07)-Ssm2a IC50
570 nM
[147]
 Toxin Info    Potassium channel toxin kappa-KTx 5.1 IC50
578.5 nM
[9- 344]
 Toxin Info    KappaPI-stichotoxin-Shd2a IC50
650 nM
[206- 345]
 Toxin Info    Potassium channel toxin AbeTx1 IC50
672 nM
[346]
 Toxin Info    Toxin MeKTx11-3 (V9G) IC50
740 nM
[319]
 Toxin Info    Discrepin IC50
764 nM
[305]
 Toxin Info    Potassium channel toxin alpha-KTx 1.16 IC50
783.2 nM
[115]
 Toxin Info    Potassium channel toxin alpha-KTx 1.16 IC50
0.780 - 2.110 μM
[115- 319]
 Toxin Info    Toxin MeKTx11-3 (S37P) IC50
1.38 μM
[319]
 Toxin Info    Kappa-conotoxin ViTx IC50
1.59 μM
[347], [348]
 Toxin Info    HelaTx1_A1S IC50
1.9366 μM
[344]
 Toxin Info    Potassium channel toxin alpha-KTx 9.1 IC50
1.95 μM
[15- 350]
 Toxin Info    Potassium channel toxin AbeTx1 (A) IC50
1.972 μM
[346]
 Toxin Info    Potassium channel toxin ShK (C12[Abu],C28[Abu]) IC50
2.107 μM
[212]
 Toxin Info    Potassium channel toxin alpha-KTx 1.16 IC50
2.11 μM
[319]
 Toxin Info    Potassium channel toxin ShK (K22[Nle]) IC50
2.5 μM
[203]
 Toxin Info    Potassium channel toxin ShK (K22A) IC50
2.5 μM
[203]
 Toxin Info    HelaTx1 (S) IC50
3.1116 μM
[344]
 Toxin Info    Pi-phymatoxin-Pcf1a IC50
3.5 μM
[351]
 Toxin Info    Kappa-conotoxin RIIIJ IC50
4 μM
[352]
 Toxin Info    HelaTx1 (11A) IC50
4.1108 μM
[344]
 Toxin Info    Potassium channel toxin AbeTx1 (R,K12A) IC50
4.548 μM
[346]
 Toxin Info    Potassium channel toxin ShK (K22[Hmc]) IC50
5 μM
[203]
 Toxin Info    Potassium channel toxin ShK (K22R) IC50
5 μM
[203]
 Toxin Info    Potassium channel toxin alpha-KTx 9.2 IC50
5.48 μM
[187- 349]
 Toxin Info    HelaTx1 (S,11A) IC50
6.0939 μM
[344]
 Toxin Info    Potassium channel toxin ShK (K22E) IC50
7.26 μM
[270]
 Toxin Info    Potassium channel toxin AbeTx1 (R,R8A) IC50
8.503 μM
[346]
 Toxin Info    Kunitz-type serine protease inhibitor HCRG21 (S5L) IC50
15.6 μM
[174]
 Toxin Info    Potassium channel toxin AbeTx1 (R,K6A) IC50
17.759 μM
[346]
 Toxin Info    Potassium channel toxin AbeTx1 (R,R10A) IC50
21.53 μM
[346]
 Toxin Info    Potassium channel toxin AbeTx1 (R,K2A) IC50
27.532 μM
[346]
 Toxin Info    Kappa-hefutoxin 3 (K20A) IC50
110.7 μM
[120]
References
Ref 1 Mapping the functional anatomy of BgK on Kv1.1, Kv1.2, and Kv1.3. Clues to design analogs with enhanced selectivity. J Biol Chem. 1999 Dec 10;274(50):35653-61. doi: 10.1074/jbc.274.50.35653.
Ref 2 Characterization of a novel radiolabeled peptide selective for a subpopulation of voltage-gated potassium channels in mammalian brain. J Biol Chem. 2002 Feb 8;277(6):3886-93. doi: 10.1074/jbc.M109886200. Epub 2001 Nov 13.
Ref 3 Snake venoms. The amino acid sequences of two proteinase inhibitor homologues from Dendroaspis angusticeps venom. Hoppe Seylers Z Physiol Chem. 1980 May;361(5):661-74. doi: 10.1515/bchm2.1980.361.1.661.
Ref 4 Energetic and structural interactions between delta-dendrotoxin and a voltage-gated potassium channel. J Mol Biol. 2000 Mar 10;296(5):1283-94. doi: 10.1006/jmbi.2000.3522.
Ref 5 Twenty years of dendrotoxins. Toxicon. 2001 Jan;39(1):15-26. doi: 10.1016/s0041-0101(00)00162-8.
Ref 6 Protease inhibitors from marine venomous animals and their counterparts in terrestrial venomous animals. Mar Drugs. 2013 Jun 14;11(6):2069-112. doi: 10.3390/md11062069.
Ref 7 Crystal structure of alpha-dendrotoxin from the green mamba venom and its comparison with the structure of bovine pancreatic trypsin inhibitor. J Mol Biol. 1992 Apr 5;224(3):671-83. doi: 10.1016/0022-2836(92)90552-u.
Ref 8 A designer ligand specific for Kv1.3 channels from a scorpion neurotoxin-based library. Proc Natl Acad Sci U S A. 2009 Dec 29;106(52):22211-6. doi: 10.1073/pnas.0910123106. Epub 2009 Dec 10.
Ref 9 Scorpion toxins interact with nicotinic acetylcholine receptors. FEBS Lett. 2019 Oct;593(19):2779-2789. doi: 10.1002/1873-3468.13530. Epub 2019 Jul 18.
Ref 10 Kaliotoxin (1-37) shows structural differences with related potassium channel blockers. Biochemistry. 1994 Nov 29;33(47):14256-63. doi: 10.1021/bi00251a038.
Ref 11 A concept for rapid protein-structure determination by solid-state NMR spectroscopy. Angew Chem Int Ed Engl. 2005 Mar 29;44(14):2089-92. doi: 10.1002/anie.200462516.
Ref 12 Toxin-induced conformational changes in a potassium channel revealed by solid-state NMR. Nature. 2006 Apr 13;440(7086):959-62. doi: 10.1038/nature04649.
Ref 13 A unified nomenclature for short-chain peptides isolated from scorpion venoms: alpha-KTx molecular subfamilies. Trends Pharmacol Sci. 1999 Nov;20(11):444-7. doi: 10.1016/s0165-6147(99)01398-x.
Ref 14 A subfamily of acidic alpha-K(+) toxins. J Biol Chem. 2004 Jan 23;279(4):2781-9. doi: 10.1074/jbc.M311029200. Epub 2003 Oct 14.
Ref 15 Structural and functional diversity of acidic scorpion potassium channel toxins. PLoS One. 2012;7(4):e35154. doi: 10.1371/journal.pone.0035154. Epub 2012 Apr 12.
Ref 16 Purification, characterization and biosynthesis of parabutoxin 3, a component of Parabuthus transvaalicus venom. Eur J Biochem. 2002 Apr;269(7):1854-65. doi: 10.1046/j.1432-1033.2002.02833.x.
Ref 17 Evidence for a function-specific mutation in the neurotoxin, parabutoxin 3. Eur J Neurosci. 2003 May;17(9):1786-92. doi: 10.1046/j.1460-9568.2003.02613.x.
Ref 18 A common "hot spot" confers hERG blockade activity to alpha-scorpion toxins affecting K+ channels. Biochem Pharmacol. 2008 Sep 15;76(6):805-15. doi: 10.1016/j.bcp.2008.07.008. Epub 2008 Jul 18.
Ref 19 Purification and characterization of three inhibitors of voltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom. Biochemistry. 1994 Jun 7;33(22):6834-9. doi: 10.1021/bi00188a012.
Ref 20 Chemical synthesis and 1H-NMR 3D structure determination of AgTx2-MTX chimera, a new potential blocker for Kv1.2 channel, derived from MTX and AgTx2 scorpion toxins. Protein Sci. 2008 Jan;17(1):107-18. doi: 10.1110/ps.073122908. Epub 2007 Nov 27.
Ref 21 Solution structure of the potassium channel inhibitor agitoxin 2: caliper for probing channel geometry. Protein Sci. 1995 Aug;4(8):1478-89. doi: 10.1002/pro.5560040805.
Ref 22 Cobatoxins 1 and 2 from Centruroides noxius Hoffmann constitute a subfamily of potassium-channel-blocking scorpion toxins. Eur J Biochem. 1998 Jun 15;254(3):468-79. doi: 10.1046/j.1432-1327.1998.2540468.x.
Ref 23 Novel K(+)-channel-blocking toxins from the venom of the scorpion Centruroides limpidus limpidus Karsch. Biochem J. 1994 Nov 15;304 ( Pt 1)(Pt 1):51-6. doi: 10.1042/bj3040051.
Ref 24 Comparative proteomic analysis of female and male venoms from the Mexican scorpion Centruroides limpidus: Novel components found. Toxicon. 2017 Jan;125:91-98. doi: 10.1016/j.toxicon.2016.11.256. Epub 2016 Nov 24.
Ref 25 Cobatoxin 1 from Centruroides noxius scorpion venom: chemical synthesis, three-dimensional structure in solution, pharmacology and docking on K+ channels. Biochem J. 2004 Jan 1;377(Pt 1):37-49. doi: 10.1042/BJ20030977.
Ref 26 Site-directed mutagenesis of dendrotoxin K reveals amino acids critical for its interaction with neuronal K+ channels. Biochemistry. 1997 Jun 24;36(25):7690-6. doi: 10.1021/bi963105g.
Ref 27 On the site by which alpha-dendrotoxin binds to voltage-dependent potassium channels: site-directed mutagenesis reveals that the lysine triplet 28-30 is not essential for binding. FEBS Lett. 1994 Dec 19;356(2-3):153-8. doi: 10.1016/0014-5793(94)01235-0.
Ref 28 Dynamic diversification from a putative common ancestor of scorpion toxins affecting sodium, potassium, and chloride channels. J Mol Evol. 1999 Feb;48(2):187-96. doi: 10.1007/pl00006457.
Ref 29 Analysis of the blocking activity of charybdotoxin homologs and iodinated derivatives against Ca2+-activated K+ channels. J Membr Biol. 1989 Aug;109(3):269-81. doi: 10.1007/BF01870284.
Ref 30 Neuromuscular effects of some potassium channel blocking toxins from the venom of the scorpion Leiurus quinquestriatus hebreus. Toxicon. 1994 Nov;32(11):1433-43. doi: 10.1016/0041-0101(94)90415-4.
Ref 31 Cloning and functional expression of dendrotoxin K from black mamba, a K+ channel blocker. Biochemistry. 1993 Jun 1;32(21):5692-7. doi: 10.1021/bi00072a026.
Ref 32 Snake venom toxins. The amino acid sequence of toxin Vi2, a homologue of pancreatic trypsin inhibitor, from Dendroaspis polylepis polylepis (black mamba) venom. Biochim Biophys Acta. 1977 Apr 25;491(2):361-9. doi: 10.1016/0005-2795(77)90279-3.
Ref 33 Novel effects of dendrotoxin homologues on subtypes of mammalian Kv1 potassium channels expressed in Xenopus oocytes. FEBS Lett. 1996 Mar 25;383(1-2):26-30. doi: 10.1016/0014-5793(96)00211-6.
Ref 34 The relative potencies of dendrotoxins as blockers of the cloned voltage-gated K+ channel, mKv1.1 (MK-1), when stably expressed in Chinese hamster ovary cells. Br J Pharmacol. 1997 Mar;120(6):1029-34. doi: 10.1038/sj.bjp.0701004.
Ref 35 Identification of residues in dendrotoxin K responsible for its discrimination between neuronal K+ channels containing Kv1.1 and 1.2 alpha subunits. Eur J Biochem. 1999 Jul;263(1):222-9. doi: 10.1046/j.1432-1327.1999.00494.x.
Ref 36 Nuclear magnetic resonance solution structure of dendrotoxin K from the venom of Dendroaspis polylepis polylepis. J Mol Biol. 1993 Dec 5;234(3):735-50. doi: 10.1006/jmbi.1993.1623.
Ref 37 Delineation of the functional site of alpha-dendrotoxin. The functional topographies of dendrotoxins are different but share a conserved core with those of other Kv1 potassium channel-blocking toxins. J Biol Chem. 1998 Sep 25;273(39):25393-403. doi: 10.1074/jbc.273.39.25393.
Ref 38 Noxiustoxin 2, a novel K+ channel blocking peptide from the venom of the scorpion Centruroides noxius Hoffmann. Toxicon. 1996 Aug;34(8):913-22. doi: 10.1016/0041-0101(96)00029-3.
Ref 39 Moving pieces in a taxonomic puzzle: venom 2D-LC/MS and data clustering analyses to infer phylogenetic relationships in some scorpions from the Buthidae family (Scorpiones). Toxicon. 2006 May;47(6):628-39. doi: 10.1016/j.toxicon.2006.01.015. Epub 2006 Mar 23.
Ref 40 Purification, sequence, and model structure of charybdotoxin, a potent selective inhibitor of calcium-activated potassium channels. Proc Natl Acad Sci U S A. 1988 May;85(10):3329-33. doi: 10.1073/pnas.85.10.3329.
Ref 41 Charybdotoxin is a new member of the K+ channel toxin family that includes dendrotoxin I and mast cell degranulating peptide. Biochemistry. 1989 Dec 12;28(25):9708-14. doi: 10.1021/bi00451a025.
Ref 42 Solution synthesis of charybdotoxin (ChTX), a K+ channel blocker. Biochem Biophys Res Commun. 1990 Jul 31;170(2):684-90. doi: 10.1016/0006-291x(90)92145-p.
Ref 43 BeKm-1 is a HERG-specific toxin that shares the structure with ChTx but the mechanism of action with ErgTx1. Biophys J. 2003 May;84(5):3022-36. doi: 10.1016/S0006-3495(03)70028-9.
Ref 44 Maurotoxin: a potent inhibitor of intermediate conductance Ca2+-activated potassium channels. Mol Pharmacol. 2003 Feb;63(2):409-18. doi: 10.1124/mol.63.2.409.
Ref 45 Multidimensional signatures in antimicrobial peptides. Proc Natl Acad Sci U S A. 2004 May 11;101(19):7363-8. doi: 10.1073/pnas.0401567101. Epub 2004 Apr 26.
Ref 46 Scorpion Potassium Channel-blocking Defensin Highlights a Functional Link with Neurotoxin. J Biol Chem. 2016 Mar 25;291(13):7097-106. doi: 10.1074/jbc.M115.680611. Epub 2016 Jan 27.
Ref 47 Molecular structure of charybdotoxin, a pore-directed inhibitor of potassium ion channels. Science. 1990 Aug 3;249(4968):521-4. doi: 10.1126/science.1696395.
Ref 48 Molecular structure of charybdotoxin: retraction. Science. 1991 May 3;252(5006):631. doi: 10.1126/science.252.5006.631.b.
Ref 49 Three-dimensional structure of natural charybdotoxin in aqueous solution by 1H-NMR. Charybdotoxin possesses a structural motif found in other scorpion toxins. Eur J Biochem. 1991 Feb 26;196(1):19-28. doi: 10.1111/j.1432-1033.1991.tb15780.x.
Ref 50 Refined structure of charybdotoxin: common motifs in scorpion toxins and insect defensins. Science. 1991 Dec 6;254(5037):1521-3. doi: 10.1126/science.1720574.
Ref 51 Analysis of side-chain organization on a refined model of charybdotoxin: structural and functional implications. Biochemistry. 1992 Sep 1;31(34):7756-64. doi: 10.1021/bi00149a003.
Ref 52 Progress in multidimensional NMR investigations of peptide and protein 3-D structures in solution. From structure to functional aspects. Biochimie. 1992 Sep-Oct;74(9-10):825-36. doi: 10.1016/0300-9084(92)90065-m.
Ref 53 NMR solution structure of a two-disulfide derivative of charybdotoxin: structural evidence for conservation of scorpion toxin alpha/beta motif and its hydrophobic side chain packing. Biochemistry. 1997 Apr 1;36(13):3760-6. doi: 10.1021/bi962720h.
Ref 54 The Birth and Death of Toxins with Distinct Functions: A Case Study in the Sea Anemone Nematostella. Mol Biol Evol. 2019 Sep 1;36(9):2001-2012. doi: 10.1093/molbev/msz132.
Ref 55 Experimental conversion of a defensin into a neurotoxin: implications for origin of toxic function. Mol Biol Evol. 2014 Mar;31(3):546-59. doi: 10.1093/molbev/msu038. Epub 2014 Jan 14.
Ref 56 Arrangement of Kv1 alpha subunits dictates sensitivity to tetraethylammonium. J Gen Physiol. 2010 Sep;136(3):273-82. doi: 10.1085/jgp.200910398.
Ref 57 Synthesis, 1H NMR structure, and activity of a three-disulfide-bridged maurotoxin analog designed to restore the consensus motif of scorpion toxins. J Biol Chem. 2000 May 5;275(18):13605-12. doi: 10.1074/jbc.275.18.13605.
Ref 58 Solution structure and functional analysis of HelaTx1: the first toxin member of the -KTx5 subfamily. BMB Rep. 2020 May;53(5):260-265. doi: 10.5483/BMBRep.2020.53.5.256.
Ref 59 A novel -conopeptide, CnIIIC, exerts potent and preferential inhibition of NaV1.2/1.4 channels and blocks neuronal nicotinic acetylcholine receptors. Br J Pharmacol. 2012 Jul;166(5):1654-68. doi: 10.1111/j.1476-5381.2012.01837.x.
Ref 60 Large-scale discovery of conopeptides and conoproteins in the injectable venom of a fish-hunting cone snail using a combined proteomic and transcriptomic approach. J Proteomics. 2012 Sep 18;75(17):5215-25. doi: 10.1016/j.jprot.2012.06.001. Epub 2012 Jun 13.
Ref 61 Peptide therapeutics from venom: Current status and potential. Bioorg Med Chem. 2018 Jun 1;26(10):2738-2758. doi: 10.1016/j.bmc.2017.09.029. Epub 2017 Sep 23.
Ref 62 The antifungal plant defensin AtPDF2.3 from Arabidopsis thaliana blocks potassium channels. Sci Rep. 2016 Aug 30;6:32121. doi: 10.1038/srep32121.
Ref 63 kappa-Conotoxin PVIIA is a peptide inhibiting the shaker K+ channel. J Biol Chem. 1998 Jan 2;273(1):33-8. doi: 10.1074/jbc.273.1.33.
Ref 64 Strategy for rapid immobilization of prey by a fish-hunting marine snail. Nature. 1996 May 9;381(6578):148-51. doi: 10.1038/381148a0.
Ref 65 The block of Shaker K+ channels by kappa-conotoxin PVIIA is state dependent. J Gen Physiol. 1999 Jul;114(1):125-40. doi: 10.1085/jgp.114.1.125.
Ref 66 Single amino acid substitutions in kappa-conotoxin PVIIA disrupt interaction with the shaker K+ channel. J Biol Chem. 2000 Aug 11;275(32):24639-44. doi: 10.1074/jbc.C900990199.
Ref 67 Molecular simulation of the interaction of kappa-conotoxin-PVIIA with the Shaker potassium channel pore. Eur Biophys J. 2001 Dec;30(7):528-36. doi: 10.1007/s00249-001-0189-8.
Ref 68 Inhibition of single Shaker K channels by kappa-conotoxin-PVIIA. Biophys J. 2002 Jun;82(6):3003-11. doi: 10.1016/S0006-3495(02)75641-5.
Ref 69 Electrostatic recognition and induced fit in the kappa-PVIIA toxin binding to Shaker potassium channel. J Am Chem Soc. 2005 May 11;127(18):6836-49. doi: 10.1021/ja042641q.
Ref 70 Postischemic administration of CGX-1051, a peptide from cone snail venom, reduces infarct size in both rat and dog models of myocardial ischemia and reperfusion. J Cardiovasc Pharmacol. 2005 Aug;46(2):141-6. doi: 10.1097/01.fjc.0000167015.84715.27.
Ref 71 Why the Drosophila Shaker K+ channel is not a good model for ligand binding to voltage-gated Kv1 channels. Biochemistry. 2013 Mar 5;52(9):1631-40. doi: 10.1021/bi301257p. Epub 2013 Feb 20.
Ref 72 Efficient enzymatic cyclization of an inhibitory cystine knot-containing peptide. Biotechnol Bioeng. 2016 Oct;113(10):2202-12. doi: 10.1002/bit.25993. Epub 2016 Aug 9.
Ref 73 Solution structure and proposed binding mechanism of a novel potassium channel toxin kappa-conotoxin PVIIA. Structure. 1997 Dec 15;5(12):1585-97. doi: 10.1016/s0969-2126(97)00307-9.
Ref 74 Three-dimensional structure of kappa-conotoxin PVIIA, a novel potassium channel-blocking toxin from cone snails. Biochemistry. 1998 Apr 21;37(16):5407-16. doi: 10.1021/bi9730341.
Ref 75 Mesomartoxin, a new K(v)1.2-selective scorpion toxin interacting with the channel selectivity filter. Biochem Pharmacol. 2015 Jan 15;93(2):232-9. doi: 10.1016/j.bcp.2014.12.002. Epub 2014 Dec 13.
Ref 76 Evolution of separate predation- and defence-evoked venoms in carnivorous cone snails. Nat Commun. 2014 Mar 24;5:3521. doi: 10.1038/ncomms4521.
Ref 77 Definition of the M-conotoxin superfamily: characterization of novel peptides from molluscivorous Conus venoms. Biochemistry. 2005 Jun 7;44(22):8176-86. doi: 10.1021/bi047541b.
Ref 78 The amino acid sequences of homologous hydroxyproline-containing myotoxins from the marine snail Conus geographus venom. FEBS Lett. 1983 May 8;155(2):277-80. doi: 10.1016/0014-5793(82)80620-0.
Ref 79 Disulfide pairings in geographutoxin I, a peptide neurotoxin from Conus geographus. FEBS Lett. 1990 May 7;264(1):29-32. doi: 10.1016/0014-5793(90)80756-9.
Ref 80 Action of derivatives of mu-conotoxin GIIIA on sodium channels. Single amino acid substitutions in the toxin separately affect association and dissociation rates. Biochemistry. 1992 Sep 8;31(35):8229-38. doi: 10.1021/bi00150a016.
Ref 81 Distinction among neuronal subtypes of voltage-activated sodium channels by mu-conotoxin PIIIA. J Neurosci. 2000 Jan 1;20(1):76-80. doi: 10.1523/JNEUROSCI.20-01-00076.2000.
Ref 82 Role of hydroxyprolines in the in vitro oxidative folding and biological activity of conotoxins. Biochemistry. 2008 Feb 12;47(6):1741-51. doi: 10.1021/bi701934m. Epub 2008 Jan 12.
Ref 83 Pruning nature: Biodiversity-derived discovery of novel sodium channel blocking conotoxins from Conus bullatus. Toxicon. 2009 Jan;53(1):90-8. doi: 10.1016/j.toxicon.2008.10.017. Epub 2008 Nov 20.
Ref 84 -Conotoxins that differentially block sodium channels NaV1.1 through 1.8 identify those responsible for action potentials in sciatic nerve. Proc Natl Acad Sci U S A. 2011 Jun 21;108(25):10302-7. doi: 10.1073/pnas.1107027108. Epub 2011 Jun 7.
Ref 85 NMR Structure of -Conotoxin GIIIC: Leucine 18 Induces Local Repacking of the N-Terminus Resulting in Reduced Na(V) Channel Potency. Molecules. 2018 Oct 22;23(10):2715. doi: 10.3390/molecules23102715.
Ref 86 Solution structure of mu-conotoxin GIIIA analysed by 2D-NMR and distance geometry calculations. FEBS Lett. 1991 Jan 28;278(2):160-6. doi: 10.1016/0014-5793(91)80107-e.
Ref 87 Tertiary structure of conotoxin GIIIA in aqueous solution. Biochemistry. 1991 Jul 16;30(28):6908-16. doi: 10.1021/bi00242a014.
Ref 88 Structure-activity relationships of mu-conotoxin GIIIA: structure determination of active and inactive sodium channel blocker peptides by NMR and simulated annealing calculations. Biochemistry. 1992 Dec 22;31(50):12577-84. doi: 10.1021/bi00165a006.
Ref 89 OsK2, a new selective inhibitor of Kv1.2 potassium channels purified from the venom of the scorpion Orthochirus scrobiculosus. Biochem Biophys Res Commun. 2001 Sep 7;286(5):841-7. doi: 10.1006/bbrc.2001.5492.
Ref 90 PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer. Toxins (Basel). 2018 Feb 7;10(2):72. doi: 10.3390/toxins10020072.
Ref 91 The precursors of the bee venom constituents apamin and MCD peptide are encoded by two genes in tandem which share the same 3'-exon. J Biol Chem. 1995 May 26;270(21):12704-8. doi: 10.1074/jbc.270.21.12704.
Ref 92 The peptide components of bee venom. Eur J Biochem. 1976 Jan 15;61(2):369-76. doi: 10.1111/j.1432-1033.1976.tb10030.x.
Ref 93 Apamin as a selective blocker of the calcium-dependent potassium channel in neuroblastoma cells: voltage-clamp and biochemical characterization of the toxin receptor. Proc Natl Acad Sci U S A. 1982 Feb;79(4):1308-12. doi: 10.1073/pnas.79.4.1308.
Ref 94 Apamin, a blocker of the calcium-activated potassium channel, induces neurodegeneration of Purkinje cells exclusively. Brain Res. 1997 Dec 19;778(2):405-8. doi: 10.1016/s0006-8993(97)01165-7.
Ref 95 Determinants of apamin and d-tubocurarine block in SK potassium channels. J Biol Chem. 1997 Sep 12;272(37):23195-200. doi: 10.1074/jbc.272.37.23195.
Ref 96 Pharmacological characterization of small-conductance Ca(2+)-activated K(+) channels stably expressed in HEK 293 cells. Br J Pharmacol. 2000 Mar;129(5):991-9. doi: 10.1038/sj.bjp.0703120.
Ref 97 SK3 is an important component of K(+) channels mediating the afterhyperpolarization in cultured rat SCG neurones. J Physiol. 2001 Sep 1;535(Pt 2):323-34. doi: 10.1111/j.1469-7793.2001.00323.x.
Ref 98 Apamin interacts with all subtypes of cloned small-conductance Ca2+-activated K+ channels. Pflugers Arch. 2001 Jan;441(4):544-50. doi: 10.1007/s004240000447.
Ref 99 An amino acid outside the pore region influences apamin sensitivity in small conductance Ca2+-activated K+ channels. J Biol Chem. 2007 Feb 9;282(6):3478-86. doi: 10.1074/jbc.M607213200. Epub 2006 Dec 1.
Ref 100 Apamin reduces neuromuscular transmission by activating inhibitory muscarinic M(2) receptors on motor nerve terminals. Eur J Pharmacol. 2010 Jan 25;626(2-3):239-43. doi: 10.1016/j.ejphar.2009.09.064. Epub 2009 Oct 8.
Ref 101 Allosteric block of KCa2 channels by apamin. J Biol Chem. 2010 Aug 27;285(35):27067-27077. doi: 10.1074/jbc.M110.110072. Epub 2010 Jun 18.
Ref 102 The small neurotoxin apamin blocks not only small conductance Ca(2+) activated K(+) channels (SK type) but also the voltage dependent Kv1.3 channel. Eur Biophys J. 2017 Sep;46(6):517-523. doi: 10.1007/s00249-016-1196-0. Epub 2017 Jan 20.
Ref 103 Apamin inhibits TNF-- and IFN--induced inflammatory cytokines and chemokines via suppressions of NF-B signaling pathway and STAT in human keratinocytes. Pharmacol Rep. 2017 Oct;69(5):1030-1035. doi: 10.1016/j.pharep.2017.04.006. Epub 2017 Apr 18.
Ref 104 Apamin Suppresses LPS-Induced Neuroinflammatory Responses by Regulating SK Channels and TLR4-Mediated Signaling Pathways. Int J Mol Sci. 2020 Jun 17;21(12):4319. doi: 10.3390/ijms21124319.
Ref 105 Apamin from bee venom suppresses inflammation in a murine model of gouty arthritis. J Ethnopharmacol. 2020 Jul 15;257:112860. doi: 10.1016/j.jep.2020.112860. Epub 2020 Apr 11.
Ref 106 Antioxidative, Antiapoptotic, and Anti-Inflammatory Effects of Apamin in a Murine Model of Lipopolysaccharide-Induced Acute Kidney Injury. Molecules. 2020 Dec 3;25(23):5717. doi: 10.3390/molecules25235717.
Ref 107 Solution structure of apamin determined by nuclear magnetic resonance and distance geometry. Biochemistry. 1988 Nov 1;27(22):8491-8. doi: 10.1021/bi00422a029.
Ref 108 Binding and toxicity of apamin. Characterization of the active site. Eur J Biochem. 1991 Mar 28;196(3):639-45. doi: 10.1111/j.1432-1033.1991.tb15860.x.
Ref 109 A novel toxin from the venom of the scorpion Tityus trivittatus, is the first member of a new alpha-KTX subfamily. FEBS Lett. 2006 Jan 23;580(2):592-6. doi: 10.1016/j.febslet.2005.12.073. Epub 2006 Jan 4.
Ref 110 A new Kaliotoxin selective towards Kv1.3 and Kv1.2 but not Kv1.1 channels expressed in oocytes. Biochem Biophys Res Commun. 2008 Nov 21;376(3):525-30. doi: 10.1016/j.bbrc.2008.09.033. Epub 2008 Sep 18.
Ref 111 BmTx3, a scorpion toxin with two putative functional faces separately active on A-type K+ and HERG currents. Biochem J. 2004 Mar 15;378(Pt 3):745-52. doi: 10.1042/BJ20031324.
Ref 112 BmBKTx1, a novel Ca2+-activated K+ channel blocker purified from the Asian scorpion Buthus martensi Karsch. J Biol Chem. 2004 Aug 13;279(33):34562-9. doi: 10.1074/jbc.M312798200. Epub 2004 Jun 3.
Ref 113 The first potassium channel toxin from the venom of the Iranian scorpion Odonthobuthus doriae. FEBS Lett. 2006 Nov 13;580(26):6254-8. doi: 10.1016/j.febslet.2006.10.029. Epub 2006 Oct 20.
Ref 114 Molecular diversity and functional evolution of scorpion potassium channel toxins. Mol Cell Proteomics. 2011 Feb;10(2):M110.002832. doi: 10.1074/mcp.M110.002832. Epub 2010 Sep 30.
Ref 115 Variability of Potassium Channel Blockers in Mesobuthus eupeus Scorpion Venom with Focus on Kv1.1: AN INTEGRATED TRANSCRIPTOMIC AND PROTEOMIC STUDY. J Biol Chem. 2015 May 8;290(19):12195-209. doi: 10.1074/jbc.M115.637611. Epub 2015 Mar 19.
Ref 116 C-Terminal residues in small potassium channel blockers OdK1 and OSK3 from scorpion venom fine-tune the selectivity. Biochim Biophys Acta Proteins Proteom. 2017 May;1865(5):465-472. doi: 10.1016/j.bbapap.2017.02.001. Epub 2017 Feb 4.
Ref 117 Structural and Functional Elucidation of Peptide Ts11 Shows Evidence of a Novel Subfamily of Scorpion Venom Toxins. Toxins (Basel). 2016 Sep 30;8(10):288. doi: 10.3390/toxins8100288.
Ref 118 OdK2, a Kv1.3 channel-selective toxin from the venom of the Iranian scorpion Odonthobuthus doriae. Toxicon. 2008 Jun 15;51(8):1424-30. doi: 10.1016/j.toxicon.2008.03.027. Epub 2008 Mar 29.
Ref 119 Synthesis and characterization of Pi4, a scorpion toxin from Pandinus imperator that acts on K+ channels. Eur J Biochem. 2003 Sep;270(17):3583-92. doi: 10.1046/j.1432-1033.2003.03743.x.
Ref 120 Assignment of voltage-gated potassium channel blocking activity to kappa-KTx1.3, a non-toxic homologue of kappa-hefutoxin-1, from Heterometrus spinifer venom. Biochem Pharmacol. 2005 Feb 15;69(4):669-78. doi: 10.1016/j.bcp.2004.10.018. Epub 2004 Dec 29.
Ref 121 The new kappa-KTx 2.5 from the scorpion Opisthacanthus cayaporum. Peptides. 2011 Jul;32(7):1509-17. doi: 10.1016/j.peptides.2011.05.017. Epub 2011 May 23.
Ref 122 Ts8 scorpion toxin inhibits the Kv4.2 channel and produces nociception in?vivo. Toxicon. 2016 Sep 1;119:244-52. doi: 10.1016/j.toxicon.2016.06.014. Epub 2016 Jun 23.
Ref 123 Sunanda, Punnepalli, et al. "Identification, chemical synthesis, structure, and function of a new KV1 channel blocking peptide from Oulactis sp." Peptide Science 110.4 (2018): e24073.
Ref 124 Structure, folding and stability of a minimal homologue from Anemonia sulcata of the sea anemone potassium channel blocker ShK. Peptides. 2018 Jan;99:169-178. doi: 10.1016/j.peptides.2017.10.001. Epub 2017 Oct 6.
Ref 125 Molecular divergence of two orthologous scorpion toxins affecting potassium channels. Comp Biochem Physiol A Mol Integr Physiol. 2011 Jul;159(3):313-21. doi: 10.1016/j.cbpa.2011.03.027. Epub 2011 Apr 3.
Ref 126 On the convergent evolution of animal toxins. Conservation of a diad of functional residues in potassium channel-blocking toxins with unrelated structures. J Biol Chem. 1997 Feb 14;272(7):4302-9. doi: 10.1074/jbc.272.7.4302.
Ref 127 kappa-Hefutoxin1, a novel toxin from the scorpion Heterometrus fulvipes with unique structure and function. Importance of the functional diad in potassium channel selectivity. J Biol Chem. 2002 Aug 16;277(33):30040-7. doi: 10.1074/jbc.M111258200. Epub 2002 May 28.
Ref 128 Synthesis and characterization of amino acid deletion analogs of -hefutoxin 1, a scorpion toxin on potassium channels. Toxicon. 2013 Sep;71:25-30. doi: 10.1016/j.toxicon.2013.05.010. Epub 2013 May 29.
Ref 129 Expanding the pharmacological profile of -hefutoxin 1 and analogues: A focus on the inhibitory effect on the oncogenic channel K(v)10.1. Peptides. 2017 Dec;98:43-50. doi: 10.1016/j.peptides.2016.08.008. Epub 2016 Aug 28.
Ref 130 Screening, large-scale production and structure-based classification of cystine-dense peptides. Nat Struct Mol Biol. 2018 Mar;25(3):270-278. doi: 10.1038/s41594-018-0033-9. Epub 2018 Feb 26.
Ref 131 Functional evolution of scorpion venom peptides with an inhibitor cystine knot fold. Biosci Rep. 2013 Jun 27;33(3):e00047. doi: 10.1042/BSR20130052.
Ref 132 Chemical synthesis and characterization of Pi1, a scorpion toxin from Pandinus imperator active on K+ channels. Eur J Biochem. 2000 Aug;267(16):5149-55. doi: 10.1046/j.1432-1327.2000.01577.x.
Ref 133 Synthesis, 3-D structure, and pharmacology of a reticulated chimeric peptide derived from maurotoxin and Tsk scorpion toxins. Biochem Biophys Res Commun. 2002 Mar 1;291(3):640-8. doi: 10.1006/bbrc.2002.6496.
Ref 134 Characterization of the first K? channel blockers from the venom of the Moroccan scorpion Buthus occitanus Paris. Toxicon. 2013 Dec 1;75:168-76. doi: 10.1016/j.toxicon.2013.03.004. Epub 2013 Mar 21.
Ref 135 Genomic organization of three novel toxins from the scorpion Buthus martensi Karsch that are active on potassium channels. Biochem J. 2000 Mar 15;346 Pt 3(Pt 3):805-9.
Ref 136 Purification, characterization, and synthesis of three novel toxins from the Chinese scorpion Buthus martensi, which act on K+ channels. Biochemistry. 1997 Nov 4;36(44):13473-82. doi: 10.1021/bi971044w.
Ref 137 A potent potassium channel blocker from Mesobuthus eupeus scorpion venom. Biochimie. 2010 Dec;92(12):1847-53. doi: 10.1016/j.biochi.2010.08.003. Epub 2010 Aug 14.
Ref 138 Solution structure of BmKTX, a K+ blocker toxin from the Chinese scorpion Buthus Martensi. Proteins. 2000 Jan 1;38(1):70-8. doi: 10.1002/(sici)1097-0134(20000101)38:1<70::aid-prot8>3.0.co;2-5.
Ref 139 An unusual fold for potassium channel blockers: NMR structure of three toxins from the scorpion Opisthacanthus madagascariensis. Biochem J. 2005 May 15;388(Pt 1):263-71. doi: 10.1042/BJ20041705.
Ref 140 Electrophysiological characterization of Ts6 and Ts7, K? channel toxins isolated through an improved Tityus serrulatus venom purification procedure. Toxins (Basel). 2014 Feb 28;6(3):892-913. doi: 10.3390/toxins6030892.
Ref 141 A Tale of Toxin Promiscuity: The Versatile Pharmacological Effects of Hcr 1b-2 Sea Anemone Peptide on Voltage-Gated Ion Channels. Mar Drugs. 2022 Feb 17;20(2):147. doi: 10.3390/md20020147.
Ref 142 Purification and characterization of Ts15, the first member of a new -KTX subfamily from the venom of the Brazilian scorpion Tityus serrulatus. Toxicon. 2011 Jul;58(1):54-61. doi: 10.1016/j.toxicon.2011.05.001. Epub 2011 May 13.
Ref 143 Production of recombinant Conkunitzin-S1 in Escherichia coli. Protein Expr Purif. 2006 Jun;47(2):640-4. doi: 10.1016/j.pep.2006.01.019. Epub 2006 Feb 20.
Ref 144 Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family. Structural and functional characterization. J Biol Chem. 2005 Jun 24;280(25):23766-70. doi: 10.1074/jbc.C500064200. Epub 2005 Apr 15.
Ref 145 Structure of conkunitzin-S1, a neurotoxin and Kunitz-fold disulfide variant from cone snail. Acta Crystallogr D Biol Crystallogr. 2006 Sep;62(Pt 9):980-90. doi: 10.1107/S0907444906021123. Epub 2006 Aug 19.
Ref 146 Venomic and transcriptomic analysis of centipede Scolopendra subspinipes dehaani. J Proteome Res. 2012 Dec 7;11(12):6197-212. doi: 10.1021/pr300881d. Epub 2012 Nov 29.
Ref 147 Chemical punch packed in venoms makes centipedes excellent predators. Mol Cell Proteomics. 2012 Sep;11(9):640-50. doi: 10.1074/mcp.M112.018853. Epub 2012 May 17.
Ref 148 A novel conotoxin from Conus striatus, mu-SIIIA, selectively blocking rat tetrodotoxin-resistant sodium channels. Toxicon. 2006 Jan;47(1):122-32. doi: 10.1016/j.toxicon.2005.10.008. Epub 2005 Dec 1.
Ref 149 Novel conotoxins from Conus striatus and Conus kinoshitai selectively block TTX-resistant sodium channels. Biochemistry. 2005 May 17;44(19):7259-65. doi: 10.1021/bi0473408.
Ref 150 A Lewis Acid-Controlled Enantiodivergent Epoxidation of Aldehydes. ACS Catal. 2023 Oct 6;13(19):13117-13126. doi: 10.1021/acscatal.3c03929. Epub 2023 Sep 25.
Ref 151 Retraction of "Effect of Fluoride Layer Growth on the Deposition Rate under Different Microchannel Structures". ACS Omega. 2024 Feb 28;9(10):12291. doi: 10.1021/acsomega.4c01652. eCollection 2024 Mar 12.
Ref 152 Retraction of "Assessing the Weathering Performance and Functionality of Nanoparticle-Enhanced High-Pressure Laminates for Building Facade Applications". ACS Omega. 2024 Mar 1;9(10):12290. doi: 10.1021/acsomega.4c01411. eCollection 2024 Mar 12.
Ref 153 Correction to "Digoxin-Mediated Inhibition of Potential Hypoxia-Related Angiogenic Repair in Modulated Electro-Hyperthermia (mEHT)-Treated Murine Triple-Negative Breast Cancer Model". ACS Pharmacol Transl Sci. 2024 Feb 28;7(3):904. doi: 10.1021/acsptsci.4c00094. eCollection 2024 Mar 8.
Ref 154 Correction to 1,2,3-Triazole Tethered Hybrid Capsaicinoids as Antiproliferative Agents Active against Lung Cancer Cells (A549). ACS Omega. 2024 Feb 20;9(9):11026. doi: 10.1021/acsomega.4c00155. eCollection 2024 Mar 5.
Ref 155 Correction to "Dual-Surfactant-Capped Ag Nanoparticles as a Highly Selective and Sensitive Colorimetric Sensor for Citrate Detection". ACS Omega. 2024 Feb 22;9(9):11025. doi: 10.1021/acsomega.3c09929. eCollection 2024 Mar 5.
Ref 156 Colloidal Stability of PFSA-Ionomer Dispersions. Part I. Single-Ion Electrostatic Interaction Potential Energies. Langmuir. 2024 Apr 2;40(13):6654-6665. doi: 10.1021/acs.langmuir.3c03903. Epub 2024 Mar 8.
Ref 157 Correction to "Searching for the Rules of Electrochemical Nitrogen Fixation". ACS Catal. 2024 Feb 14;14(5):3169-3170. doi: 10.1021/acscatal.4c00448. eCollection 2024 Mar 1.
Ref 158 Correction to "Quantification and Mapping of Alkylation in the Human Genome Reveal Single Nucleotide Resolution Precursors of Mutational Signatures". ACS Cent Sci. 2024 Jan 25;10(2):487. doi: 10.1021/acscentsci.3c01597. eCollection 2024 Feb 28.
Ref 159 Correction to "Characterization of Proteins Extracted from Ulva sp., Padina sp., and Laurencia sp. Macroalgae Using Green Technology: Effect of In Vitro Digestion on Antioxidant and ACE-I Inhibitory Activity". ACS Omega. 2024 Feb 16;9(8):9848. doi: 10.1021/acsomega.4c00407. eCollection 2024 Feb 27.
Ref 160 Erratum: Antibacterial Efficacy of ZnO/Bentonite (Clay) Nanocomposites against Multidrug-Resistant Escherichia coli. ACS Omega. 2024 Feb 15;9(8):9847. doi: 10.1021/acsomega.4c00630. eCollection 2024 Feb 27.
Ref 161 Low-Cost Nonfused-Ring Electron Acceptors Enabled by Noncovalent Conformational Locks. Acc Chem Res. 2024 Mar 19;57(6):981-991. doi: 10.1021/acs.accounts.3c00813. Epub 2024 Mar 3.
Ref 162 Retraction of "Hydrogenolysis of Polyethylene and Polypropylene into Propane over Cobalt-Based Catalysts". JACS Au. 2024 Feb 7;4(2):865. doi: 10.1021/jacsau.4c00090. eCollection 2024 Feb 26.
Ref 163 Correction to "Comprehensive Study of Preparation of Carboxy Group-Containing Cellulose Fibers from Dry-Lap Kraft Pulps by Catalytic Oxidation with Solid NaOCl". ACS Sustain Chem Eng. 2024 Feb 6;12(7):2921-2923. doi: 10.1021/acssuschemeng.4c00215. eCollection 2024 Feb 19.
Ref 164 Correction to "Dissolution Behavior of Polycyclic Aromatic Hydrocarbons in Heavy Oil in the Presence of Supercritical Cyclohexane". ACS Omega. 2024 Jan 31;9(6):7269. doi: 10.1021/acsomega.4c00064. eCollection 2024 Feb 13.
Ref 165 Retraction of "Fe(3)O(4) Nanoparticles Grown on Cellulose/GO Hydrogels as Advanced Catalytic Materials for the Heterogeneous Fenton-like Reaction". ACS Omega. 2024 Jan 31;9(6):7270. doi: 10.1021/acsomega.4c00561. eCollection 2024 Feb 13.
Ref 166 Correction to "Ligand Chromophore Modification Approach for Predictive Incremental Tuning of Metal-Organic Framework Color". Chem Mater. 2024 Jan 19;36(3):1773. doi: 10.1021/acs.chemmater.3c03160. eCollection 2024 Feb 13.
Ref 167 Correction to "Electrospun Nanofibrous UV Filters with Bidirectional Actuation Properties Based on Salmon Sperm DNA/Silk Fibroin for Biomedical Applications". ACS Omega. 2024 Jan 25;9(5):6025. doi: 10.1021/acsomega.4c00072. eCollection 2024 Feb 6.
Ref 168 Correction to "Iterative Dual-Metal and Energy Transfer Catalysis Enables Stereodivergence in Alkyne Difunctionalization: Carboboration as Case Study". ACS Catal. 2024 Jan 22;14(3):1976. doi: 10.1021/acscatal.4c00200. eCollection 2024 Feb 2.
Ref 169 Correction to "Nanotechnology Impact on Chemical-Enhanced Oil Recovery: A Review and Bibliometric Analysis of Recent Developments". ACS Omega. 2024 Jan 15;9(4):5083. doi: 10.1021/acsomega.3c10450. eCollection 2024 Jan 30.
Ref 170 Neuronally micro-conotoxins from Conus striatus utilize an alpha-helical motif to target mammalian sodium channels. J Biol Chem. 2008 Aug 1;283(31):21621-8. doi: 10.1074/jbc.M802852200. Epub 2008 Jun 3.
Ref 171 N- and C-terminal extensions of -conotoxins increase potency and selectivity for neuronal sodium channels. Biopolymers. 2012;98(2):161-5. doi: 10.1002/bip.22032. Epub 2012 Feb 10.
Ref 172 Structure, dynamics, and selectivity of the sodium channel blocker mu-conotoxin SIIIA. Biochemistry. 2008 Oct 14;47(41):10940-9. doi: 10.1021/bi801010u. Epub 2008 Sep 18.
Ref 173 Kbot55, purified from Buthus occitanus tunetanus venom, represents the first member of a novel -KTx subfamily. Peptides. 2016 Jun;80:4-8. doi: 10.1016/j.peptides.2015.05.015. Epub 2015 Jun 14.
Ref 174 Kunitz-Type Peptides from the Sea Anemone Heteractis crispa Demonstrate Potassium Channel Blocking and Anti-Inflammatory Activities. Biomedicines. 2020 Nov 4;8(11):473. doi: 10.3390/biomedicines8110473.
Ref 175 A single-point mutation enhances dual functionality of a scorpion toxin. Comp Biochem Physiol C Toxicol Pharmacol. 2016 Jan;179:72-8. doi: 10.1016/j.cbpc.2015.09.002. Epub 2015 Sep 7.
Ref 176 BcsTx3 is a founder of a novel sea anemone toxin family of potassium channel blocker. FEBS J. 2013 Oct;280(19):4839-52. doi: 10.1111/febs.12456. Epub 2013 Aug 23.
Ref 177 Purification, characterization and gene cloning of a novel phospholipase A2 from the venom of Agkistrodon blomhoffii ussurensis. Int J Biochem Cell Biol. 2005 Mar;37(3):558-65. doi: 10.1016/j.biocel.2004.05.022.
Ref 178 Neurotoxic activity of Gln49 phospholipase A(2) from Gloydius ussuriensis snake venom. J Appl Toxicol. 2007 Sep-Oct;27(5):447-52. doi: 10.1002/jat.1222.
Ref 179 Mechanisms of analgesic action of Gln49-PLA(2) from Gloydius ussurensis snake venom. Appl Biochem Biotechnol. 2010 Mar;160(3):773-9. doi: 10.1007/s12010-009-8573-4. Epub 2009 Mar 10.
Ref 180 Crystal structure of Natratoxin, a novel snake secreted phospholipaseA2 neurotoxin from Naja atra venom inhibiting A-type K+ currents. Proteins. 2008 Aug;72(2):673-83. doi: 10.1002/prot.21964.
Ref 181 mu-Conotoxin PIIIA, a new peptide for discriminating among tetrodotoxin-sensitive Na channel subtypes. J Neurosci. 1998 Jun 15;18(12):4473-81. doi: 10.1523/JNEUROSCI.18-12-04473.1998.
Ref 182 Co-expression of Na(V) subunits alters the kinetics of inhibition of voltage-gated sodium channels by pore-blocking -conotoxins. Br J Pharmacol. 2013 Apr;168(7):1597-610. doi: 10.1111/bph.12051.
Ref 183 Structurally diverse -conotoxin PIIIA isomers block sodium channel NaV 1.4. Angew Chem Int Ed Engl. 2012 Apr 23;51(17):4058-61. doi: 10.1002/anie.201107011. Epub 2012 Mar 12.
Ref 184 Solution structure of mu-conotoxin PIIIA, a preferential inhibitor of persistent tetrodotoxin-sensitive sodium channels. J Biol Chem. 2002 Jul 26;277(30):27247-55. doi: 10.1074/jbc.M201611200. Epub 2002 May 2.
Ref 185 Purification and partial characterization of K+ channel blockers from the venom of Dendroaspis angusticeps. Neurochem Int. 1992 Jun;20(4):553-8. doi: 10.1016/0197-0186(92)90034-o.
Ref 186 Characterization of Kbot21 Reveals Novel Side Chain Interactions of Scorpion Toxins Inhibiting Voltage-Gated Potassium Channels. PLoS One. 2015 Sep 23;10(9):e0137611. doi: 10.1371/journal.pone.0137611. eCollection 2015.
Ref 187 Genomic organization of three neurotoxins active on small conductance Ca2+-activated potassium channels from the scorpion Buthus martensi Karsch. FEBS Lett. 1999 Jun 11;452(3):360-4. doi: 10.1016/s0014-5793(99)00651-1.
Ref 188 Scorpion Toxin, BmP01, Induces Pain by Targeting TRPV1 Channel. Toxins (Basel). 2015 Sep 14;7(9):3671-87. doi: 10.3390/toxins7093671.
Ref 189 Characterization of four toxins from Buthus martensi scorpion venom, which act on apamin-sensitive Ca2+-activated K+ channels. Eur J Biochem. 1997 Apr 15;245(2):457-64. doi: 10.1111/j.1432-1033.1997.00457.x.
Ref 190 Solution structure of BmP01 from the venom of scorpion Buthus martensii Karsch. Biochem Biophys Res Commun. 2000 Oct 5;276(3):1148-54. doi: 10.1006/bbrc.2000.3435.
Ref 191 Potassium channel blockade by the B subunit of beta-bungarotoxin. Mol Pharmacol. 1990 Aug;38(2):164-9.
Ref 192 Purification, molecular cloning and functional characterization of HelaTx1 (Heterometrus laoticus): the first member of a new -KTX subfamily. Biochem Pharmacol. 2012 May 1;83(9):1307-17. doi: 10.1016/j.bcp.2012.01.021. Epub 2012 Jan 24.
Ref 193 Synthesis, characterization, and application of cy-dye- and alexa-dye-labeled hongotoxin(1) analogues. The first high affinity fluorescence probes for voltage-gated K+ channels. Bioconjug Chem. 2002 May-Jun;13(3):416-25. doi: 10.1021/bc015543s.
Ref 194 A four-disulphide-bridged toxin, with high affinity towards voltage-gated K+ channels, isolated from Heterometrus spinnifer (Scorpionidae) venom. Biochem J. 1997 Nov 15;328 ( Pt 1)(Pt 1):321-7. doi: 10.1042/bj3280321.
Ref 195 Free energy simulations of binding of HsTx1 toxin to Kv1 potassium channels: the basis of Kv1.3/Kv1.1 selectivity. J Phys Chem B. 2014 Jan 23;118(3):707-16. doi: 10.1021/jp410950h. Epub 2014 Jan 13.
Ref 196 A potent and Kv1.3-selective analogue of the scorpion toxin HsTX1 as a potential therapeutic for autoimmune diseases. Sci Rep. 2014 Mar 28;4:4509. doi: 10.1038/srep04509.
Ref 197 Prolonged immunomodulation in inflammatory arthritis using the selective Kv1.3 channel blocker HsTX1[R14A] and its PEGylated analog. Clin Immunol. 2017 Jul;180:45-57. doi: 10.1016/j.clim.2017.03.014. Epub 2017 Apr 4.
Ref 198 Structural and functional consequences of the presence of a fourth disulfide bridge in the scorpion short toxins: solution structure of the potassium channel inhibitor HsTX1. Protein Sci. 1999 Dec;8(12):2672-85. doi: 10.1110/ps.8.12.2672.
Ref 199 Evidence for domain-specific recognition of SK and Kv channels by MTX and HsTx1 scorpion toxins. J Biol Chem. 2004 Dec 31;279(53):55690-6. doi: 10.1074/jbc.M410055200. Epub 2004 Oct 21.
Ref 200 The impact of the fourth disulfide bridge in scorpion toxins of the alpha-KTx6 subfamily. Proteins. 2005 Dec 1;61(4):1010-23. doi: 10.1002/prot.20681.
Ref 201 Characterization of a potassium channel toxin from the Caribbean Sea anemone Stichodactyla helianthus. Toxicon. 1995 May;33(5):603-13. doi: 10.1016/0041-0101(95)00013-c.
Ref 202 Chemical synthesis and characterization of ShK toxin: a potent potassium channel inhibitor from a sea anemone. Int J Pept Protein Res. 1995 Nov;46(5):354-8. doi: 10.1111/j.1399-3011.1995.tb01068.x.
Ref 203 Identification of three separate binding sites on SHK toxin, a potent inhibitor of voltage-dependent potassium channels in human T-lymphocytes and rat brain. Biochem Biophys Res Commun. 1996 Feb 27;219(3):696-701. doi: 10.1006/bbrc.1996.0297.
Ref 204 Structural conservation of the pores of calcium-activated and voltage-gated potassium channels determined by a sea anemone toxin. J Biol Chem. 1999 Jul 30;274(31):21885-92. doi: 10.1074/jbc.274.31.21885.
Ref 205 Targeting effector memory T cells with a selective peptide inhibitor of Kv1.3 channels for therapy of autoimmune diseases. Mol Pharmacol. 2005 Apr;67(4):1369-81. doi: 10.1124/mol.104.008193. Epub 2005 Jan 21.
Ref 206 Development of a rational nomenclature for naming peptide and protein toxins from sea anemones. Toxicon. 2012 Sep 15;60(4):539-50. doi: 10.1016/j.toxicon.2012.05.020. Epub 2012 Jun 5.
Ref 207 Defensin-neurotoxin dyad in a basally branching metazoan sea anemone. FEBS J. 2017 Oct;284(19):3320-3338. doi: 10.1111/febs.14194. Epub 2017 Sep 6.
Ref 208 Development of a sea anemone toxin as an immunomodulator for therapy of autoimmune diseases. Toxicon. 2012 Mar 15;59(4):529-46. doi: 10.1016/j.toxicon.2011.07.016. Epub 2011 Aug 12.
Ref 209 Sea Anemones: Quiet Achievers in the Field of Peptide Toxins. Toxins (Basel). 2018 Jan 8;10(1):36. doi: 10.3390/toxins10010036.
Ref 210 Solution structure of ShK toxin, a novel potassium channel inhibitor from a sea anemone. Nat Struct Biol. 1996 Apr;3(4):317-20. doi: 10.1038/nsb0496-317.
Ref 211 ShK-Dap22, a potent Kv1.3-specific immunosuppressive polypeptide. J Biol Chem. 1998 Dec 4;273(49):32697-707. doi: 10.1074/jbc.273.49.32697.
Ref 212 Role of disulfide bonds in the structure and potassium channel blocking activity of ShK toxin. Biochemistry. 1999 Nov 2;38(44):14549-58. doi: 10.1021/bi991282m.
Ref 213 Engineering a stable and selective peptide blocker of the Kv1.3 channel in T lymphocytes. Mol Pharmacol. 2009 Apr;75(4):762-73. doi: 10.1124/mol.108.052704. Epub 2009 Jan 2.
Ref 214 Native chemical ligation at Asx-Cys, Glx-Cys: chemical synthesis and high-resolution X-ray structure of ShK toxin by racemic protein crystallography. J Am Chem Soc. 2013 Aug 14;135(32):11911-9. doi: 10.1021/ja4046795. Epub 2013 Aug 6.
Ref 215 Pharmaceutical Optimization of Peptide Toxins for Ion Channel Targets: Potent, Selective, and Long-Lived Antagonists of Kv1.3. J Med Chem. 2015 Sep 10;58(17):6784-802. doi: 10.1021/acs.jmedchem.5b00495. Epub 2015 Aug 31.
Ref 216 Inversion of the Side-Chain Stereochemistry of Indvidual Thr or Ile Residues in a Protein Molecule: Impact on the Folding, Stability, and Structure of the ShK Toxin. Angew Chem Int Ed Engl. 2017 Mar 13;56(12):3324-3328. doi: 10.1002/anie.201612398. Epub 2017 Feb 14.
Ref 217 KTX3, the kaliotoxin from Buthus occitanus tunetanus scorpion venom: one of an extensive family of peptidyl ligands of potassium channels. Toxicon. 2000 Jan;38(1):105-11. doi: 10.1016/s0041-0101(99)00137-3.
Ref 218 Modelling Alzheimer's disease in a dish: dissecting amyloid- metabolism in human neurons. Neuronal Signal. 2024 Jan 11;8(1):NS20230020. doi: 10.1042/NS20230020. eCollection 2024 Jan.
Ref 219 A commentary on the paper, 'Development and validation of a novel automatable assay for cholesterol efflux capacity'. Biosci Rep. 2023 Jun 28;43(6):BSR20230124. doi: 10.1042/BSR20230124.
Ref 220 Retracted: Chen, Y, Zhang, W, Kadier, A, Zhang, H, Yao, X. MicroRNA-769-5p suppresses cell growth and migration via targeting NUSAP1 in bladder cancer. J Clin Lab Anal. 2020; 34:e23193. J Clin Lab Anal. 2023 Apr;37(8):e24893. doi: 10.1002/jcla.24893. Epub 2023 May 14.
Ref 221 New mechanisms for the kidney-protective effect of alkali in chronic kidney disease. Clin Sci (Lond). 2022 Oct 28;136(20):1433-1437. doi: 10.1042/CS20220395.
Ref 222 ANGPTL1, Foxo3a-Sox2, and colorectal cancer metastasis. Clin Sci (Lond). 2022 Sep 30;136(18):1367-1370. doi: 10.1042/CS20220394.
Ref 223 Microglia-Mediated Neuroinflammation: A Potential Target for the Treatment of Cardiovascular Diseases. J Inflamm Res. 2022 May 25;15:3083-3094. doi: 10.2147/JIR.S350109. eCollection 2022.
Ref 224 Angiotensin receptors - affinitiy and beyond. Clin Sci (Lond). 2022 May 27;136(10):799-802. doi: 10.1042/CS20220024.
Ref 225 Utility of preclinical models of altered maternal nutrition to support the developmental origins of health and disease hypothesis. Clin Sci (Lond). 2022 May 27;136(10):711-714. doi: 10.1042/CS20211175.
Ref 226 SARS-CoV-2 spike protein causes cardiovascular disease independent of viral infection. Clin Sci (Lond). 2022 Mar 31;136(6):431-434. doi: 10.1042/CS20220028.
Ref 227 Microbiota transplantation in portal hypertension: promises and pitfalls. Clin Sci (Lond). 2022 Mar 31;136(6):425-429. doi: 10.1042/CS20220029.
Ref 228 Paradoxical effects of osteoprotegerin on vascular function: inhibiting inflammation while promoting oxidative stress?. Clin Sci (Lond). 2022 Mar 18;136(5):379-382. doi: 10.1042/CS20211096.
Ref 229 MicroRNAs as messengers of liver diseases: has the message finally been decrypted?. Clin Sci (Lond). 2022 Mar 18;136(5):323-328. doi: 10.1042/CS20211177.
Ref 230 Commentary on: Xbp1s-Ddit3, DNA damage and pulmonary hypertension. Clin Sci (Lond). 2022 Jan 14;136(1):163-166. doi: 10.1042/CS20211095.
Ref 231 A commentary on the paper: 'Evaluation of spice and herb as phytoderived selective modulators of human retinaldehyde dehydrogenases using a simple in vitro method'. Biosci Rep. 2022 Jan 28;42(1):BSR20211522. doi: 10.1042/BSR20211522.
Ref 232 Countering the classical renin-angiotensin system. Clin Sci (Lond). 2021 Dec 10;135(23):2619-2623. doi: 10.1042/CS20211043.
Ref 233 Commentary on: Screening of immunosuppressive cells from colorectal adenocarcinoma and identification of prognostic markers. Biosci Rep. 2021 Dec 22;41(12):BSR20211096. doi: 10.1042/BSR20211096.
Ref 234 Double agent indole-3-acetic acid: mechanistic analysis of indole-3-acetaldehyde dehydrogenase AldA that synthesizes IAA, an auxin that aids bacterial virulence. Biosci Rep. 2021 Aug 27;41(8):BSR20210598. doi: 10.1042/BSR20210598.
Ref 235 Targeting the 'garbage-bin' to fight cancer: HDAC6 inhibitor WT161 has an anti-tumor effect on osteosarcoma and synergistically interacts with 5-FU. Biosci Rep. 2021 Aug 27;41(8):BSR20210952. doi: 10.1042/BSR20210952.
Ref 236 Soluble (pro)renin receptor: a novel ligand for angiotensin II type 1 receptor?. Clin Sci (Lond). 2021 Jul 16;135(13):1627-1630. doi: 10.1042/CS20210227.
Ref 237 Promyelocytic leukemia protein: an atherosclerosis suppressor protein?. Clin Sci (Lond). 2021 Jul 16;135(13):1557-1561. doi: 10.1042/CS20210314.
Ref 238 Solution structure of two new toxins from the venom of the Chinese scorpion Buthus martensi Karsch blockers of potassium channels. Biochemistry. 1998 Sep 8;37(36):12412-8. doi: 10.1021/bi9809371.
Ref 239 Retraction: Role of mesenchymal stem cells versus angiotensin converting enzyme inhibitor in kidney repair. Nephrology (Carlton). 2024 Apr;29(4):239. doi: 10.1111/nep.14278. Epub 2024 Feb 11.
Ref 240 Photogeneration and quenching of singlet molecular oxygen by bacterial C(40) carotenoids with long chain of conjugated double bonds. Photosynth Res. 2024 Mar;159(2-3):291-301. doi: 10.1007/s11120-023-01070-6. Epub 2024 Feb 5.
Ref 241 Density Functional Theory, Molecular Dynamics and AlteQ Studies Approaches of Baimantuoluoamide A and Baimantuoluoamide B to Identify Potential Inhibitors of M(pro) Proteins: a Novel Target for the Treatment of SARS COVID-19. JETP Lett. 2023 May 15:1-10. doi: 10.1134/S0021364023600039. Online ahead of print.
Ref 242 Melatonin Confers NaCl Tolerance in Withaniacoagulans L. by Maintaining Na(+)/K(+) Homeostasis, Strengthening the Antioxidant Defense System and Modulating Withanolides Synthesis-Related Genes. Russ J Plant Physiol. 2023;70(3):52. doi: 10.1134/S1021443723600125. Epub 2023 May 23.
Ref 243 Rhodococcus rhodochrous IEGM 1360, an Effective Biocatalyst of C3 Oxidative Transformation of Oleanane Triterpenoids. Microbiology (N Y). 2023;92(2):204-214. doi: 10.1134/S0026261722603360. Epub 2023 Apr 21.
Ref 244 Quaternary Ammonium Salt Strategy and Molecular Docking Studies of Novel 5-Acyl-8-(Arylamino)-Quinolines by Acetyl and Methanesulfonyl Chloride for Dual Evaluation Bioactivity. Russ J Bioorg Chem. 2023;49(2):367-375. doi: 10.1134/S1068162023020097. Epub 2023 Feb 21.
Ref 245 Erratum to: Prospects for the Use of Marine Sulfated Fucose-Rich Polysaccharides in Treatment and Prevention of COVID-19 and Post-COVID-19 Syndrome. Russ J Bioorg Chem. 2022;48(6):1372. doi: 10.1134/S1068162022340015. Epub 2022 Dec 23.
Ref 246 Current Trends and Approaches to the Search for Genetic Determinants of Aging and Longevity. Russ J Genet. 2022;58(12):1427-1443. doi: 10.1134/S1022795422120067. Epub 2022 Dec 28.
Ref 247 Design, Synthesis, Anti-Tubercular Evaluation and Teratogenicity Studies of Furanyl Pyrazolo[3,4-b] Quinoline-5-Ones. Russ J Bioorg Chem. 2023;49(1):127-138. doi: 10.1134/S1068162023010053. Epub 2022 Dec 22.
Ref 248 Rapid Assessment of Neutralizing Antibodies Using Influenza Viruses with a Luciferase Reporter. Appl Biochem Microbiol. 2022;58(7):878-886. doi: 10.1134/S0003683822070067. Epub 2022 Dec 6.
Ref 249 Analysis of adiabatic trapping phenomena for quasi-integrable area-preserving maps in the presence of time-dependent exciters. Phys Rev E. 2022 Sep;106(3-1):034204. doi: 10.1103/PhysRevE.106.034204.
Ref 250 Synthesis, Antiviral, and Antibacterial Activity of the Glycyrrhizic Acid and Glycyrrhetinic Acid Derivatives. Russ J Bioorg Chem. 2022;48(5):906-918. doi: 10.1134/S1068162022050132. Epub 2022 Jul 28.
Ref 251 Erratum to: Evaluation of the Effects of Favipiravir Combined with Vitamin C on Alveolar Bone in Rats. J Evol Biochem Physiol. 2022;58(3):941. doi: 10.1134/S0022093022030280. Epub 2022 Jun 29.
Ref 252 Design, Synthesis, and Molecular Docking Studies of Some New Quinoxaline Derivatives as EGFR Targeting Agents. Russ J Bioorg Chem. 2022;48(3):565-575. doi: 10.1134/S1068162022030220. Epub 2022 Jun 21.
Ref 253 Identification of Some Promising Heterocycles Useful in Treatment of Allergic Rhinitis: Virtual Screening, Pharmacophore Mapping, Molecular Docking, and Molecular Dynamics. Russ J Bioorg Chem. 2022;48(2):438-456. doi: 10.1134/S1068162022330019. Epub 2022 May 26.
Ref 254 Erratum to: Experimental Search for New Means of Pathogenetic Therapy COVID-19: Inhibitor of H2-Receptors Famotidine Increases the Effect of Oseltamivir on Survival and Immune Status of Mice Infected by A/PR/8/34 (H1N1). J Evol Biochem Physiol. 2022;58(2):623. doi: 10.1134/S0022093022020284. Epub 2022 May 16.
Ref 255 MicroRNAs as the Potential Regulators of SARS-CoV-2 Infection and Modifiers of the COVID-19 Clinical Features. Mol Biol. 2022;56(1):29-45. doi: 10.1134/S0026893322010034. Epub 2022 Feb 12.
Ref 256 Predators as Control Agents of Mosquito Larvae in Micro-Reservoirs (Review). Inland Water Biol. 2022;15(1):39-53. doi: 10.1134/S1995082922010138. Epub 2022 Mar 12.
Ref 257 Molecular Beacon DNA Probes with Fluorescein Bifluorophore. Russ J Bioorg Chem. 2021;47(3):734-740. doi: 10.1134/S1068162021030055. Epub 2021 Jun 11.
Ref 258 Synthesis, Molecular Docking, In Silico ADME Predictions, and Toxicity Studies of N-Substituted-5-(4-Chloroquinolin-2-yl)-1,3,4-Thiadiazol-2-Amine Derivatives as COVID-19 Inhibitors. Russ J Bioorg Chem. 2021;47(1):158-165. doi: 10.1134/S1068162021010155. Epub 2021 Mar 20.
Ref 259 Molecular cloning and genomic organization of a K(+) channel toxin from the Chinese scorpion Buthus martensii Karsch. Toxicon. 2001 Feb-Mar;39(2-3):407-10. doi: 10.1016/s0041-0101(00)00130-6.
Ref 260 Chemical synthesis and characterization of maurotoxin, a short scorpion toxin with four disulfide bridges that acts on K+ channels. Eur J Biochem. 1996 Dec 15;242(3):491-8. doi: 10.1111/j.1432-1033.1996.0491r.x.
Ref 261 Maurotoxin, a four disulfide bridge toxin from Scorpio maurus venom: purification, structure and action on potassium channels. FEBS Lett. 1997 Apr 14;406(3):284-90. doi: 10.1016/s0014-5793(97)00285-8.
Ref 262 Maurotoxin, a four disulfide bridges scorpion toxin acting on K+ channels. Toxicon. 1998 Nov;36(11):1609-11. doi: 10.1016/s0041-0101(98)00153-6.
Ref 263 Mechanisms of maurotoxin action on Shaker potassium channels. Biophys J. 2000 Aug;79(2):776-87. doi: 10.1016/S0006-3495(00)76335-1.
Ref 264 Maurotoxin versus Pi1/HsTx1 scorpion toxins. Toward new insights in the understanding of their distinct disulfide bridge patterns. J Biol Chem. 2000 Dec 15;275(50):39394-402. doi: 10.1074/jbc.M006810200.
Ref 265 Effect of maurotoxin, a four disulfide-bridged toxin from the chactoid scorpion Scorpio maurus, on Shaker K+ channels. J Pept Res. 2000 Jun;55(6):419-27. doi: 10.1034/j.1399-3011.2000.00715.x.
Ref 266 Design and characterization of a highly selective peptide inhibitor of the small conductance calcium-activated K+ channel, SkCa2. J Biol Chem. 2001 Nov 16;276(46):43145-51. doi: 10.1074/jbc.M106981200. Epub 2001 Aug 29.
Ref 267 Increasing the molecular contacts between maurotoxin and Kv1.2 channel augments ligand affinity. Proteins. 2005 Aug 15;60(3):401-11. doi: 10.1002/prot.20509.
Ref 268 A bifunctional sea anemone peptide with Kunitz type protease and potassium channel inhibiting properties. Biochem Pharmacol. 2011 Jul 1;82(1):81-90. doi: 10.1016/j.bcp.2011.03.023. Epub 2011 Apr 6.
Ref 269 Tuning Scorpion Toxin Selectivity: Switching From K(V)1.1 to K(V)1.3. Front Pharmacol. 2020 Jul 7;11:1010. doi: 10.3389/fphar.2020.01010. eCollection 2020.
Ref 270 An essential binding surface for ShK toxin interaction with rat brain potassium channels. Biochemistry. 1996 Dec 24;35(51):16407-11. doi: 10.1021/bi962463g.
Ref 271 A new potassium channel toxin from the sea anemone Heteractis magnifica: isolation, cDNA cloning, and functional expression. Biochemistry. 1997 Sep 23;36(38):11461-71. doi: 10.1021/bi970253d.
Ref 272 Genomic structure of a potassium channel toxin from Heteractis magnifica. FEBS Lett. 1997 Nov 24;418(1-2):183-8. doi: 10.1016/s0014-5793(97)01365-3.
Ref 273 A potassium channel toxin from the secretion of the sea anemone Bunodosoma granulifera. Isolation, amino acid sequence and biological activity. Biochim Biophys Acta. 1993 May 7;1157(1):86-92. doi: 10.1016/0304-4165(93)90082-j.
Ref 274 A potassium-channel toxin from the sea anemone Bunodosoma granulifera, an inhibitor for Kv1 channels. Revision of the amino acid sequence, disulfide-bridge assignment, chemical synthesis, and biological activity. Eur J Biochem. 1997 Feb 15;244(1):192-202. doi: 10.1111/j.1432-1033.1997.00192.x.
Ref 275 Peptide fingerprinting of the neurotoxic fractions isolated from the secretions of sea anemones Stichodactyla helianthus and Bunodosoma granulifera. New members of the APETx-like family identified by a 454 pyrosequencing approach. Peptides. 2012 Mar;34(1):26-38. doi: 10.1016/j.peptides.2011.10.011. Epub 2011 Oct 12.
Ref 276 Two novel toxins from the venom of the scorpion Pandinus imperator show that the N-terminal amino acid sequence is important for their affinities towards Shaker B K+ channels. J Membr Biol. 1996 Jul;152(1):49-56. doi: 10.1007/s002329900084.
Ref 277 Solution structure for Pandinus toxin K-alpha (PiTX-K alpha), a selective blocker of A-type potassium channels. Biochemistry. 1997 Mar 11;36(10):2763-71. doi: 10.1021/bi9628432.
Ref 278 Genomic organization and cloning of novel genes encoding toxin-like peptides of three superfamilies from the spider Orinithoctonus huwena. Peptides. 2008 Oct;29(10):1679-84. doi: 10.1016/j.peptides.2008.06.001. Epub 2008 Jun 12.
Ref 279 Discovery of a distinct superfamily of Kunitz-type toxin (KTT) from tarantulas. PLoS One. 2008;3(10):e3414. doi: 10.1371/journal.pone.0003414. Epub 2008 Oct 15.
Ref 280 Molecular diversification based on analysis of expressed sequence tags from the venom glands of the Chinese bird spider Ornithoctonus huwena. Toxicon. 2008 Jun 15;51(8):1479-89. doi: 10.1016/j.toxicon.2008.03.024. Epub 2008 Mar 27.
Ref 281 An overview of peptide toxins from the venom of the Chinese bird spider Selenocosmia huwena Wang [=Ornithoctonus huwena (Wang)]. Toxicon. 2004 Apr;43(5):575-85. doi: 10.1016/j.toxicon.2004.02.005.
Ref 282 Nuclear magnetic resonance studies on huwentoxin-XI from the Chinese bird spider Ornithoctonus huwena: 15N labeling and sequence-specific 1H, 15N nuclear magnetic resonance assignments. Acta Biochim Biophys Sin (Shanghai). 2006 Jul;38(7):457-66. doi: 10.1111/j.1745-7270.2006.00191.x.
Ref 283 New Kunitz-Type HCRG Polypeptides from the Sea Anemone Heteractis crispa. Mar Drugs. 2015 Sep 24;13(10):6038-63. doi: 10.3390/md13106038.
Ref 284 Sea Anemone Kunitz-Type Peptides Demonstrate Neuroprotective Activity in the 6-Hydroxydopamine Induced Neurotoxicity Model. Biomedicines. 2021 Mar 10;9(3):283. doi: 10.3390/biomedicines9030283.
Ref 285 Hemitoxin, the first potassium channel toxin from the venom of the Iranian scorpion Hemiscorpius lepturus. FEBS J. 2008 Sep;275(18):4641-50. doi: 10.1111/j.1742-4658.2008.06607.x. Epub 2008 Aug 11.
Ref 286 Biochemical and electrophysiological characterization of two sea anemone type 1 potassium toxins from a geographically distant population of Bunodosoma caissarum. Mar Drugs. 2013 Mar 6;11(3):655-79. doi: 10.3390/md11030655.
Ref 287 Primary structure of a potassium channel toxin from the sea anemone Actinia equina. FEBS Lett. 1998 May 1;427(1):149-51. doi: 10.1016/s0014-5793(98)00403-7.
Ref 288 Screening of expression libraries using ELISA: identification of immunogenic proteins from Tityus bahiensis and Tityus serrulatus venom. Toxicon. 2001 May;39(5):679-85. doi: 10.1016/s0041-0101(00)00194-x.
Ref 289 Novel components of Tityus serrulatus venom: A transcriptomic approach. Toxicon. 2021 Jan 15;189:91-104. doi: 10.1016/j.toxicon.2020.11.001. Epub 2020 Nov 10.
Ref 290 Evidence for a new class of scorpion toxins active against K+ channels. FEBS Lett. 1998 Jul 24;431(3):375-80. doi: 10.1016/s0014-5793(98)00780-7.
Ref 291 Tityus serrulatus venom peptidomics: assessing venom peptide diversity. Toxicon. 2008 Oct;52(5):611-8. doi: 10.1016/j.toxicon.2008.07.010. Epub 2008 Jul 31.
Ref 292 Tityustoxin K alpha blocks voltage-gated noninactivating K+ channels and unblocks inactivating K+ channels blocked by alpha-dendrotoxin in synaptosomes. Proc Natl Acad Sci U S A. 1994 Feb 15;91(4):1475-9. doi: 10.1073/pnas.91.4.1475.
Ref 293 Tityus serrulatus scorpion venom and toxins: an overview. Protein Pept Lett. 2009;16(8):920-32. doi: 10.2174/092986609788923329.
Ref 294 Letter: An anti-inflammatory peptide from bee venom. Nature. 1973 Sep 21;245(5421):163-4. doi: 10.1038/245163a0.
Ref 295 Mast cell degranulating peptide: a multi-functional neurotoxin. J Pharm Pharmacol. 1990 Jul;42(7):457-61. doi: 10.1111/j.2042-7158.1990.tb06595.x.
Ref 296 Disulfide bridges and blockage of Shaker B K(+)-channels by another butantoxin peptide purified from the Argentinean scorpion Tityus trivittatus. Toxicon. 2003 Feb;41(2):173-9. doi: 10.1016/s0041-0101(02)00247-7.
Ref 297 NMR solution structure of butantoxin. Arch Biochem Biophys. 2000 Jul 1;379(1):18-27. doi: 10.1006/abbi.2000.1858.
Ref 298 Proteomic endorsed transcriptomic profiles of venom glands from Tityus obscurus and T. serrulatus scorpions. PLoS One. 2018 Mar 21;13(3):e0193739. doi: 10.1371/journal.pone.0193739. eCollection 2018.
Ref 299 TsTX-IV, a short chain four-disulfide-bridged neurotoxin from Tityus serrulatus venom which acts on Ca2+-activated K+ channels. Toxicon. 1999 Apr;37(4):651-60. doi: 10.1016/s0041-0101(98)00206-2.
Ref 300 Covalent structure and some pharmacological features of native and cleaved alpha-KTx12-1, a four disulfide-bridged toxin from Tityus serrulatus venom. J Pept Sci. 2003 Feb;9(2):132-40. doi: 10.1002/psc.440.
Ref 301 Influence of post-starvation extraction time and prey-specific diet in Tityus serrulatus scorpion venom composition and hyaluronidase activity. Toxicon. 2014 Nov;90:326-36. doi: 10.1016/j.toxicon.2014.08.064. Epub 2014 Sep 6.
Ref 302 Tityus serrulatus venom and toxins Ts1, Ts2 and Ts6 induce macrophage activation and production of immune mediators. Toxicon. 2011 Jun;57(7-8):1101-8. doi: 10.1016/j.toxicon.2011.04.017. Epub 2011 Apr 29.
Ref 303 Ts6 and Ts2 from Tityus serrulatus venom induce inflammation by mechanisms dependent on lipid mediators and cytokine production. Toxicon. 2013 Jan;61:1-10. doi: 10.1016/j.toxicon.2012.10.002. Epub 2012 Oct 22.
Ref 304 Probing the pH-dependent structural features of alpha-KTx12.1, a potassium channel blocker from the scorpion Tityus serrulatus. Protein Sci. 2005 Apr;14(4):1025-38. doi: 10.1110/ps.041131205.
Ref 305 A positive charge at the N-terminal segment of Discrepin increases the blocking effect of K+ channels responsible for the IA currents in cerebellum granular cells. Biochim Biophys Acta. 2008 Apr;1780(4):750-5. doi: 10.1016/j.bbagen.2008.01.012. Epub 2008 Jan 30.
Ref 306 K+ channel types targeted by synthetic OSK1, a toxin from Orthochirus scrobiculosus scorpion venom. Biochem J. 2005 Jan 1;385(Pt 1):95-104. doi: 10.1042/BJ20041379.
Ref 307 Pharmacological profiling of Orthochirus scrobiculosus toxin 1 analogs with a trimmed N-terminal domain. Mol Pharmacol. 2006 Jan;69(1):354-62. doi: 10.1124/mol.105.017210. Epub 2005 Oct 18.
Ref 308 Three-dimensional structure of toxin OSK1 from Orthochirus scrobiculosus scorpion venom. Biochemistry. 1997 Feb 11;36(6):1223-32. doi: 10.1021/bi9614390.
Ref 309 Cytolytic and K+ channel blocking activities of beta-KTx and scorpine-like peptides purified from scorpion venoms. Cell Mol Life Sci. 2008 Jan;65(1):187-200. doi: 10.1007/s00018-007-7370-x.
Ref 310 Isolation and cDNA cloning of a potassium channel peptide toxin from the sea anemone Anemonia erythraea. Toxicon. 2006 Oct;48(5):536-42. doi: 10.1016/j.toxicon.2006.07.002. Epub 2006 Jul 7.
Ref 311 Proteomic analysis of the venom from the scorpion Tityus stigmurus: biochemical and physiological comparison with other Tityus species. Comp Biochem Physiol C Toxicol Pharmacol. 2007 Jul-Aug;146(1-2):147-157. doi: 10.1016/j.cbpc.2006.12.004. Epub 2006 Dec 16.
Ref 312 Wide phylogenetic distribution of Scorpine and long-chain beta-KTx-like peptides in scorpion venoms: identification of "orphan" components. Peptides. 2007 Jan;28(1):31-7. doi: 10.1016/j.peptides.2006.06.012. Epub 2006 Dec 1.
Ref 313 MeuTXKbeta1, a scorpion venom-derived two-domain potassium channel toxin-like peptide with cytolytic activity. Biochim Biophys Acta. 2010 Apr;1804(4):872-83. doi: 10.1016/j.bbapap.2009.12.017. Epub 2010 Jan 4.
Ref 314 A novel structural class of K+-channel blocking toxin from the scorpion Pandinus imperator. Biochem J. 1996 May 1;315 ( Pt 3)(Pt 3):977-81. doi: 10.1042/bj3150977.
Ref 315 Block of ShakerB K+ channels by Pi1, a novel class of scorpion toxin. FEBS Lett. 1997 Jan 3;400(2):197-200. doi: 10.1016/s0014-5793(96)01387-7.
Ref 316 Pandinus imperator scorpion venom blocks voltage-gated K+ channels in human lymphocytes. Biochem Biophys Res Commun. 1998 Jan 26;242(3):621-5. doi: 10.1006/bbrc.1997.8018.
Ref 317 The 'functional' dyad of scorpion toxin Pi1 is not itself a prerequisite for toxin binding to the voltage-gated Kv1.2 potassium channels. Biochem J. 2004 Jan 1;377(Pt 1):25-36. doi: 10.1042/BJ20030115.
Ref 318 A novel potassium channel blocking toxin from the scorpion Pandinus imperator: A 1H NMR analysis using a nano-NMR probe. Biochemistry. 1997 Mar 4;36(9):2649-58. doi: 10.1021/bi9617116.
Ref 319 K(V)1.2 channel-specific blocker from Mesobuthus eupeus scorpion venom: Structural basis of selectivity. Neuropharmacology. 2018 Dec;143:228-238. doi: 10.1016/j.neuropharm.2018.09.030. Epub 2018 Sep 22.
Ref 320 Kbot1, a three disulfide bridges toxin from Buthus occitanus tunetanus venom highly active on both SK and Kv channels. Peptides. 2004 Apr;25(4):637-45. doi: 10.1016/j.peptides.2004.02.017.
Ref 321 Transcriptome analysis of the venom gland of the Mexican scorpion Hadrurus gertschi (Arachnida: Scorpiones). BMC Genomics. 2007 May 16;8:119. doi: 10.1186/1471-2164-8-119.
Ref 322 Solution structure and antiparasitic activity of scorpine-like peptides from Hoffmannihadrurus gertschi. FEBS Lett. 2016 Jul;590(14):2286-96. doi: 10.1002/1873-3468.12255. Epub 2016 Jun 30.
Ref 323 PHAB toxins: a unique family of predatory sea anemone toxins evolving via intra-gene concerted evolution defines a new peptide fold. Cell Mol Life Sci. 2018 Dec;75(24):4511-4524. doi: 10.1007/s00018-018-2897-6. Epub 2018 Aug 14.
Ref 324 Nucleotide sequence of crotamine isoform precursors from a single South American rattlesnake (Crotalus durissus terrificus). Toxicon. 1999 Jul;37(7):973-84. doi: 10.1016/s0041-0101(98)00226-8.
Ref 325 Structure and chromosomal localization of the gene for crotamine, a toxin from the South American rattlesnake, Crotalus durissus terrificus. Toxicon. 2003 Dec;42(7):747-52. doi: 10.1016/j.toxicon.2003.10.019.
Ref 326 Crotamine pharmacology revisited: novel insights based on the inhibition of KV channels. Mol Pharmacol. 2012 Jul;82(1):90-6. doi: 10.1124/mol.112.078188. Epub 2012 Apr 12.
Ref 327 Effect of crotamine, a toxin of South American rattlesnake venom, on the sodium channel of murine skeletal muscle. Br J Pharmacol. 1978 Jul;63(3):551-9. doi: 10.1111/j.1476-5381.1978.tb07811.x.
Ref 328 The analgesic activity of crotamine, a neurotoxin from Crotalus durissus terrificus (South American rattlesnake) venom: a biochemical and pharmacological study. Toxicon. 1998 Dec;36(12):1927-37. doi: 10.1016/s0041-0101(98)00117-2.
Ref 329 Crotamine is a novel cell-penetrating protein from the venom of rattlesnake Crotalus durissus terrificus. FASEB J. 2004 Sep;18(12):1407-9. doi: 10.1096/fj.03-1459fje. Epub 2004 Jul 1.
Ref 330 Crotamine mediates gene delivery into cells through the binding to heparan sulfate proteoglycans. J Biol Chem. 2007 Jul 20;282(29):21349-60. doi: 10.1074/jbc.M604876200. Epub 2007 May 9.
Ref 331 Crotamine inhibits preferentially fast-twitching muscles but is inactive on sodium channels. Toxicon. 2007 Sep 15;50(4):553-62. doi: 10.1016/j.toxicon.2007.04.026. Epub 2007 May 18.
Ref 332 Cytotoxic effects of crotamine are mediated through lysosomal membrane permeabilization. Toxicon. 2008 Sep 1;52(3):508-17. doi: 10.1016/j.toxicon.2008.06.029. Epub 2008 Jul 10.
Ref 333 Selective reciprocity in antimicrobial activity versus cytotoxicity of hBD-2 and crotamine. Proc Natl Acad Sci U S A. 2009 Sep 1;106(35):14972-7. doi: 10.1073/pnas.0904465106. Epub 2009 Aug 13.
Ref 334 Crotamine toxicity and efficacy in mouse models of melanoma. Expert Opin Investig Drugs. 2011 Sep;20(9):1189-200. doi: 10.1517/13543784.2011.602064.
Ref 335 In vitro antibacterial and hemolytic activities of crotamine, a small basic myotoxin from rattlesnake Crotalus durissus. J Antibiot (Tokyo). 2011 Apr;64(4):327-31. doi: 10.1038/ja.2011.10. Epub 2011 Mar 9.
Ref 336 The natural cell-penetrating peptide crotamine targets tumor tissue in vivo and triggers a lethal calcium-dependent pathway in cultured cells. Mol Pharm. 2012 Feb 6;9(2):211-21. doi: 10.1021/mp2000605. Epub 2011 Dec 23.
Ref 337 Unraveling the antifungal activity of a South American rattlesnake toxin crotamine. Biochimie. 2013 Feb;95(2):231-40. doi: 10.1016/j.biochi.2012.09.019. Epub 2012 Sep 26.
Ref 338 Biological versatility of crotamine--a cationic peptide from the venom of a South American rattlesnake. Expert Opin Investig Drugs. 2010 Dec;19(12):1515-25. doi: 10.1517/13543784.2010.534457. Epub 2010 Nov 10.
Ref 339 Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom. Eur J Biochem. 2003 May;270(9):1969-79. doi: 10.1046/j.1432-1033.2003.03563.x.
Ref 340 Automated NMR structure determination and disulfide bond identification of the myotoxin crotamine from Crotalus durissus terrificus. Toxicon. 2005 Dec 1;46(7):759-67. doi: 10.1016/j.toxicon.2005.07.018. Epub 2005 Sep 26.
Ref 341 A large number of novel Ergtoxin-like genes and ERG K+-channels blocking peptides from scorpions of the genus Centruroides. FEBS Lett. 2002 Dec 4;532(1-2):121-6. doi: 10.1016/s0014-5793(02)03652-9.
Ref 342 Isolation of a long-lasting eag-related gene-type K+ current in MMQ lactotrophs and its accommodating role during slow firing and prolactin release. J Neurosci. 2002 May 1;22(9):3414-25. doi: 10.1523/JNEUROSCI.22-09-03414.2002.
Ref 343 Isolation of the first toxin from the scorpion Buthus occitanus israelis showing preference for Shaker potassium channels. FEBS Lett. 2007 May 29;581(13):2478-84. doi: 10.1016/j.febslet.2007.04.065. Epub 2007 Apr 30.
Ref 344 Effects of deletion and insertion of amino acids on the activity of HelaTx1, a scorpion toxin on potassium channels. Toxicon. 2016 Mar 1;111:1-5. doi: 10.1016/j.toxicon.2015.12.014. Epub 2015 Dec 24.
Ref 345 Novel peptide toxins from the sea anemone Stichodactyla haddoni. Peptides. 2008 Apr;29(4):536-44. doi: 10.1016/j.peptides.2007.12.010. Epub 2008 Feb 19.
Ref 346 AbeTx1 Is a Novel Sea Anemone Toxin with a Dual Mechanism of Action on Shaker-Type K? Channels Activation. Mar Drugs. 2018 Oct 1;16(10):360. doi: 10.3390/md16100360.
Ref 347 A novel conotoxin inhibiting vertebrate voltage-sensitive potassium channels. Toxicon. 2003 Jul;42(1):43-52. doi: 10.1016/s0041-0101(03)00099-0.
Ref 348 Novel conopeptides of the I-superfamily occur in several clades of cone snails. Toxicon. 2004 Oct;44(5):539-48. doi: 10.1016/j.toxicon.2004.07.006.
Ref 349 Molecular cloning and sequencing of two 'short chain' and two 'long chain' K(+) channel-blocking peptides from the Chinese scorpion Buthus martensii Karsch. FEBS Lett. 1999 Sep 3;457(3):509-14. doi: 10.1016/s0014-5793(99)01101-1.
Ref 350 Solution structure of BmP02, a new potassium channel blocker from the venom of the Chinese scorpion Buthus martensi Karsch. Biochemistry. 2000 Nov 14;39(45):13669-75. doi: 10.1021/bi000860s.
Ref 351 A novel sea anemone peptide that inhibits acid-sensing ion channels. Peptides. 2014 Mar;53:3-12. doi: 10.1016/j.peptides.2013.06.003. Epub 2013 Jun 10.
Ref 352 Biochemical characterization of kappaM-RIIIJ, a Kv1.2 channel blocker: evaluation of cardioprotective effects of kappaM-conotoxins. J Biol Chem. 2010 May 14;285(20):14882-14889. doi: 10.1074/jbc.M109.068486. Epub 2010 Mar 10.
Ref 353 Protein surface topography as a tool to enhance the selective activity of a potassium channel blocker. J Biol Chem. 2019 Nov 29;294(48):18349-18359. doi: 10.1074/jbc.RA119.010494. Epub 2019 Sep 18.
Ref 354 Structural similarity between defense peptide from wheat and scorpion neurotoxin permits rational functional design. J Biol Chem. 2014 May 16;289(20):14331-40. doi: 10.1074/jbc.M113.530477. Epub 2014 Mar 26.
Ref 355 First report on BaltCRP, a cysteine-rich secretory protein (CRISP) from Bothrops alternatus venom: Effects on potassium channels and inflammatory processes. Int J Biol Macromol. 2019 Nov 1;140:556-567. doi: 10.1016/j.ijbiomac.2019.08.108. Epub 2019 Aug 14.
Ref 356 Artificial pore blocker acts specifically on voltage-gated potassium channel isoform K(V)1.6. J Biol Chem. 2022 Nov;298(11):102467. doi: 10.1016/j.jbc.2022.102467. Epub 2022 Sep 8.
Ref 357 Fluorescent protein-scorpion toxin chimera is a convenient molecular tool for studies of potassium channels. Sci Rep. 2016 Sep 21;6:33314. doi: 10.1038/srep33314.
Ref 358 AgTx2-GFP, Fluorescent Blocker Targeting Pharmacologically Important K(v)1.x (x = 1, 3, 6) Channels. Toxins (Basel). 2023 Mar 18;15(3):229. doi: 10.3390/toxins15030229.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.