General Information of This Peptide
Peptide ID
BTDP008452
Peptide Name
Potassium channel toxin alpha-KTx 1.6
Symonym
BmTX2; Neurotoxin TX2
Species
Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)
Uniprot Name
KAX16_MESMA
Alphafold ID
Q9NII5
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 2BMT
Sequence
MKISFLLLLAIVICSIGWTEAQFTNVSCSASSQCWPVCKKLFGTYRGKCMNSKCRCYS
   Click to Show/Hide
Sequence Length
58
Mass (Da)
6507
Signal Sequence
MKISFLLLLAIVICSIGWTEA
   Click to Show/Hide
Sequence Removed Signal Peptide
QFTNVSCSASSQCWPVCKKLFGTYRGKCMNSKCRCYS
   Click to Show/Hide
Disulfide Bond
28-49;34-54;38-56
PDB ID
2BMT
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Arthropoda
Class: Arachnida
Order: Scorpiones
Family: Buthidae
Genus: Mesobuthus
Species: Mesobuthus martensii
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Kv11 Inhibition rate
60 %
5 μM
Blocker
[4]
 Target Info    Kv1 IC50
0.12 nM
.
Blocker
[2- 25]
 Target Info    KCa1.1 IC50
0.3 nM
.
Blocker
[2- 25]
 Target Info    Kv1.3 IC50
1.6 nM
.
Blocker
[2- 25]
References
Ref 1 Genomic organization of three novel toxins from the scorpion Buthus martensi Karsch that are active on potassium channels. Biochem J. 2000 Mar 15;346 Pt 3(Pt 3):805-9.
Ref 2 Molecular cloning and genomic organization of a K(+) channel toxin from the Chinese scorpion Buthus martensii Karsch. Toxicon. 2001 Feb-Mar;39(2-3):407-10. doi: 10.1016/s0041-0101(00)00130-6.
Ref 3 Purification, characterization, and synthesis of three novel toxins from the Chinese scorpion Buthus martensi, which act on K+ channels. Biochemistry. 1997 Nov 4;36(44):13473-82. doi: 10.1021/bi971044w.
Ref 4 A common "hot spot" confers hERG blockade activity to alpha-scorpion toxins affecting K+ channels. Biochem Pharmacol. 2008 Sep 15;76(6):805-15. doi: 10.1016/j.bcp.2008.07.008. Epub 2008 Jul 18.
Ref 5 Solution structure of two new toxins from the venom of the Chinese scorpion Buthus martensi Karsch blockers of potassium channels. Biochemistry. 1998 Sep 8;37(36):12412-8. doi: 10.1021/bi9809371.
Ref 6 Modelling Alzheimer's disease in a dish: dissecting amyloid- metabolism in human neurons. Neuronal Signal. 2024 Jan 11;8(1):NS20230020. doi: 10.1042/NS20230020. eCollection 2024 Jan.
Ref 7 A commentary on the paper, 'Development and validation of a novel automatable assay for cholesterol efflux capacity'. Biosci Rep. 2023 Jun 28;43(6):BSR20230124. doi: 10.1042/BSR20230124.
Ref 8 Retracted: Chen, Y, Zhang, W, Kadier, A, Zhang, H, Yao, X. MicroRNA-769-5p suppresses cell growth and migration via targeting NUSAP1 in bladder cancer. J Clin Lab Anal. 2020; 34:e23193. J Clin Lab Anal. 2023 Apr;37(8):e24893. doi: 10.1002/jcla.24893. Epub 2023 May 14.
Ref 9 New mechanisms for the kidney-protective effect of alkali in chronic kidney disease. Clin Sci (Lond). 2022 Oct 28;136(20):1433-1437. doi: 10.1042/CS20220395.
Ref 10 ANGPTL1, Foxo3a-Sox2, and colorectal cancer metastasis. Clin Sci (Lond). 2022 Sep 30;136(18):1367-1370. doi: 10.1042/CS20220394.
Ref 11 Microglia-Mediated Neuroinflammation: A Potential Target for the Treatment of Cardiovascular Diseases. J Inflamm Res. 2022 May 25;15:3083-3094. doi: 10.2147/JIR.S350109. eCollection 2022.
Ref 12 Angiotensin receptors - affinitiy and beyond. Clin Sci (Lond). 2022 May 27;136(10):799-802. doi: 10.1042/CS20220024.
Ref 13 Utility of preclinical models of altered maternal nutrition to support the developmental origins of health and disease hypothesis. Clin Sci (Lond). 2022 May 27;136(10):711-714. doi: 10.1042/CS20211175.
Ref 14 SARS-CoV-2 spike protein causes cardiovascular disease independent of viral infection. Clin Sci (Lond). 2022 Mar 31;136(6):431-434. doi: 10.1042/CS20220028.
Ref 15 Microbiota transplantation in portal hypertension: promises and pitfalls. Clin Sci (Lond). 2022 Mar 31;136(6):425-429. doi: 10.1042/CS20220029.
Ref 16 Paradoxical effects of osteoprotegerin on vascular function: inhibiting inflammation while promoting oxidative stress?. Clin Sci (Lond). 2022 Mar 18;136(5):379-382. doi: 10.1042/CS20211096.
Ref 17 MicroRNAs as messengers of liver diseases: has the message finally been decrypted?. Clin Sci (Lond). 2022 Mar 18;136(5):323-328. doi: 10.1042/CS20211177.
Ref 18 Commentary on: Xbp1s-Ddit3, DNA damage and pulmonary hypertension. Clin Sci (Lond). 2022 Jan 14;136(1):163-166. doi: 10.1042/CS20211095.
Ref 19 A commentary on the paper: 'Evaluation of spice and herb as phytoderived selective modulators of human retinaldehyde dehydrogenases using a simple in vitro method'. Biosci Rep. 2022 Jan 28;42(1):BSR20211522. doi: 10.1042/BSR20211522.
Ref 20 Countering the classical renin-angiotensin system. Clin Sci (Lond). 2021 Dec 10;135(23):2619-2623. doi: 10.1042/CS20211043.
Ref 21 Commentary on: Screening of immunosuppressive cells from colorectal adenocarcinoma and identification of prognostic markers. Biosci Rep. 2021 Dec 22;41(12):BSR20211096. doi: 10.1042/BSR20211096.
Ref 22 Double agent indole-3-acetic acid: mechanistic analysis of indole-3-acetaldehyde dehydrogenase AldA that synthesizes IAA, an auxin that aids bacterial virulence. Biosci Rep. 2021 Aug 27;41(8):BSR20210598. doi: 10.1042/BSR20210598.
Ref 23 Targeting the 'garbage-bin' to fight cancer: HDAC6 inhibitor WT161 has an anti-tumor effect on osteosarcoma and synergistically interacts with 5-FU. Biosci Rep. 2021 Aug 27;41(8):BSR20210952. doi: 10.1042/BSR20210952.
Ref 24 Soluble (pro)renin receptor: a novel ligand for angiotensin II type 1 receptor?. Clin Sci (Lond). 2021 Jul 16;135(13):1627-1630. doi: 10.1042/CS20210227.
Ref 25 Promyelocytic leukemia protein: an atherosclerosis suppressor protein?. Clin Sci (Lond). 2021 Jul 16;135(13):1557-1561. doi: 10.1042/CS20210314.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.