General Information of This Peptide
Peptide ID
BTDP008428
Peptide Name
Mu-conotoxin GIIIA
Symonym
G3.9; Geographutoxin I; Myotoxin I
Species
Conus geographus (Geography cone) (Nubecula geographus)
Uniprot Name
CM3A_CONGE
Alphafold ID
P01523
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1TCG
Sequence
MMSKLGVLLTICLLLFPLTALPMDGDEPANRPVERMQDNISSEQYPLFEKRRDCCTPPKK
CKDRQCKPQRCCAGR
   Click to Show/Hide
Sequence Length
75
Mass (Da)
8586
Signal Sequence
MMSKLGVLLTICLLLFPLTALP
   Click to Show/Hide
Sequence Removed Signal Peptide
MDGDEPANRPVERMQDNISSEQYPLFEKRRDCCTPPKKCKDRQCKPQRCCAGR
   Click to Show/Hide
Disulfide Bond
54-66;55-71;61-72
PDB ID
1TCG , 1TCH , 1TCJ , 1TCK
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Mollusca
Class: Gastropoda
Order: Neogastropoda
Family: Conidae
Genus: Conus
Species: Conus geographus
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Kv1.4 Inhibition rate .
100 μM
. [1- 13]
 Target Info    Kv1.2 Inhibition rate .
100 μM
. [1- 13]
 Target Info    Kv1.3 Inhibition rate .
100 μM
. [1- 13]
 Target Info    Kv1.5 Inhibition rate .
100 μM
. [1- 13]
 Target Info    Kv1.6 Inhibition rate .
100 μM
. [1- 13]
 Target Info    Kv1 Inhibition rate .
100 μM
. [1- 13]
 Target Info    Kv2.1 Inhibition rate .
100 μM
. [1- 13]
 Target Info    Nav1.4 IC50
19 - 110 nM
. . [1- 15]
 Target Info    Nav1.1 IC50
260 nM
. . [1- 15]
 Target Info    Nav1.6 IC50
680 nM
. . [1- 15]
 Target Info    Nav1.2 IC50
2.7 - 17.8 μM
. . [1- 15]
References
Ref 1 Evolution of separate predation- and defence-evoked venoms in carnivorous cone snails. Nat Commun. 2014 Mar 24;5:3521. doi: 10.1038/ncomms4521.
Ref 2 Definition of the M-conotoxin superfamily: characterization of novel peptides from molluscivorous Conus venoms. Biochemistry. 2005 Jun 7;44(22):8176-86. doi: 10.1021/bi047541b.
Ref 3 The amino acid sequences of homologous hydroxyproline-containing myotoxins from the marine snail Conus geographus venom. FEBS Lett. 1983 May 8;155(2):277-80. doi: 10.1016/0014-5793(82)80620-0.
Ref 4 Disulfide pairings in geographutoxin I, a peptide neurotoxin from Conus geographus. FEBS Lett. 1990 May 7;264(1):29-32. doi: 10.1016/0014-5793(90)80756-9.
Ref 5 Action of derivatives of mu-conotoxin GIIIA on sodium channels. Single amino acid substitutions in the toxin separately affect association and dissociation rates. Biochemistry. 1992 Sep 8;31(35):8229-38. doi: 10.1021/bi00150a016.
Ref 6 Distinction among neuronal subtypes of voltage-activated sodium channels by mu-conotoxin PIIIA. J Neurosci. 2000 Jan 1;20(1):76-80. doi: 10.1523/JNEUROSCI.20-01-00076.2000.
Ref 7 Role of hydroxyprolines in the in vitro oxidative folding and biological activity of conotoxins. Biochemistry. 2008 Feb 12;47(6):1741-51. doi: 10.1021/bi701934m. Epub 2008 Jan 12.
Ref 8 Pruning nature: Biodiversity-derived discovery of novel sodium channel blocking conotoxins from Conus bullatus. Toxicon. 2009 Jan;53(1):90-8. doi: 10.1016/j.toxicon.2008.10.017. Epub 2008 Nov 20.
Ref 9 -Conotoxins that differentially block sodium channels NaV1.1 through 1.8 identify those responsible for action potentials in sciatic nerve. Proc Natl Acad Sci U S A. 2011 Jun 21;108(25):10302-7. doi: 10.1073/pnas.1107027108. Epub 2011 Jun 7.
Ref 10 NMR Structure of -Conotoxin GIIIC: Leucine 18 Induces Local Repacking of the N-Terminus Resulting in Reduced Na(V) Channel Potency. Molecules. 2018 Oct 22;23(10):2715. doi: 10.3390/molecules23102715.
Ref 11 Solution structure of mu-conotoxin GIIIA analysed by 2D-NMR and distance geometry calculations. FEBS Lett. 1991 Jan 28;278(2):160-6. doi: 10.1016/0014-5793(91)80107-e.
Ref 12 Tertiary structure of conotoxin GIIIA in aqueous solution. Biochemistry. 1991 Jul 16;30(28):6908-16. doi: 10.1021/bi00242a014.
Ref 13 Structure-activity relationships of mu-conotoxin GIIIA: structure determination of active and inactive sodium channel blocker peptides by NMR and simulated annealing calculations. Biochemistry. 1992 Dec 22;31(50):12577-84. doi: 10.1021/bi00165a006.
Ref 14 Conus geographus toxins that discriminate between neuronal and muscle sodium channels. J Biol Chem. 1985 Aug 5;260(16):9280-8.
Ref 15 Active site of mu-conotoxin GIIIA, a peptide blocker of muscle sodium channels. J Biol Chem. 1991 Sep 15;266(26):16989-91.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.