Peptide Information
General Information of This Peptide
| Peptide ID |
BTDP008429
|
|||||
|---|---|---|---|---|---|---|
| Peptide Name |
Mu-conotoxin PIIIA
|
|||||
| Symonym |
Mu-conotoxin P3.7
|
|||||
| Species |
Conus purpurascens (Purple cone)
|
|||||
| Uniprot Name | ||||||
| Alphafold ID | ||||||
| 3D Structure |
|
|||||
| Sequence |
MSKLGVLLTICLLLFPITALPMDGDQPADRLAERMQDNISSEEHPFEKRQRLCCGFPKSC
RSRQCKPHRCCGR Click to Show/Hide
|
|||||
| Sequence Length |
73
|
|||||
| Mass (Da) |
8334
|
|||||
| Signal Sequence |
MSKLGVLLTICLLLFPITA
Click to Show/Hide
|
|||||
| Sequence Removed Signal Peptide |
LPMDGDQPADRLAERMQDNISSEEHPFEKRQRLCCGFPKSCRSRQCKPHRCCGR
Click to Show/Hide
|
|||||
| Disulfide Bond |
53-70;53-65;54-71;54-70;60-71;60-65
|
|||||
| PDB ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Full List of Activity Data of This Peptide Toxin
| Target Name | Activity Data Type | Activity Data | Concentration | Note | Reference |
|---|---|---|---|---|---|
| Target Info Kv1.4 | Inhibition rate | . |
100 μM
|
. | [1- 9] |
| Target Info Kv1.2 | Inhibition rate | . |
100 μM
|
. | [1- 9] |
| Target Info Kv1.3 | Inhibition rate | . |
100 μM
|
. | [1- 9] |
| Target Info Kv1.5 | Inhibition rate | . |
100 μM
|
. | [1- 9] |
| Target Info Kv2.1 | Inhibition rate | . |
100 μM
|
. | [1- 9] |
| Target Info Kv1 | Inhibition rate |
73 %
|
100 μM
|
. | [1- 9] |
| Target Info Kv1.6 | Inhibition rate |
80 %
|
100 μM
|
. | [1- 9] |
| Target Info Nav1.4 | IC50 |
36 - 41 nM
|
. | . | [1- 9] |
| Target Info Nav1.6 | IC50 |
100 nM
|
. | . | [1- 9] |
| Target Info Nav1.1 | IC50 |
120 nM
|
. | . | [1- 9] |
| Target Info Nav1.2 | IC50 |
620 nM
|
. | . | [1- 9] |
| Target Info Nav1.7 | IC50 |
>100 μM
|
. | . | [1- 9] |
| Target Info Nav1.5 | IC50 |
3.1 - 6.2 μM
|
. | . | [1- 9] |
| Target Info Nav1.3 | IC50 |
3.2 μM
|
. | . | [1- 9] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
