General Information of This Target
Target ID
BTDT00212
Target Name
Potassium voltage-gated channel subfamily A member 1 (Kcna1);Potassium voltage-gated channel subfamily A member 2 (Kcna2)
Target Bioclass
Transporter and channel
Uniprot ID
P10499 ; P63142
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
Kcna1;Kcna2
Gene ID
24520 ; 25468
Synonym 1
RBKI; RCK1; Voltage-gated potassium channel subunit Kv1.1
Synonym 2
RAK; RBK2; RCK5; Voltage-gated potassium channel subunit Kv1.2
Sequence 1
MTVMSGENADEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY
ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS
IVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRF
FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF
RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP
DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE
GEEQAQLLHVSSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTA
TDQNCVNKSKLLTDV

    Click to Show/Hide
Sequence 2
MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPS
IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA
NCTLANTNYVNITKMLTDV

    Click to Show/Hide
Family1
the potassium channel family
Family2
the potassium channel family
Function 1
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney. Contributes to the regulation of the membrane potential and nerve signaling, and prevents neuronal hyperexcitability. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA1 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heterotetrameric channel formed by KCNA1 and KCNA4 shows rapid inactivation. Regulates neuronal excitability in hippocampus, especially in mossy fibers and medial perforant path axons, preventing neuronal hyperexcitability. Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA) release. Plays a role in regulating the generation of action potentials and preventing hyperexcitability in myelinated axons of the vagus nerve, and thereby contributes to the regulation of heart contraction. Required for normal neuromuscular responses. Regulates the frequency of neuronal action potential firing in response to mechanical stimuli, and plays a role in the perception of pain caused by mechanical stimuli, but does not play a role in the perception of pain due to heat stimuli. Required for normal responses to auditory stimuli and precise location of sound sources, but not for sound perception. The use of toxins that block specific channels suggest that it contributes to the regulation of the axonal release of the neurotransmitter dopamine. Required for normal postnatal brain development and normal proliferation of neuronal precursor cells in the brain. Plays a role in the reabsorption of Mg(2+) in the distal convoluted tubules in the kidney and in magnesium ion homeostasis, probably via its effect on the membrane potential.

    Click to Show/Hide
Function 2
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the cardiovascular system. Prevents aberrant action potential firing and regulates neuronal output. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to a particular potassium channel family member. Homotetrameric KCNA2 forms a delayed- rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heteromultimer formed by KCNA2 and KCNA4 shows rapid inactivation. Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. KCNA2- containing channels play a presynaptic role and prevent hyperexcitability and aberrant action potential firing. Response to toxins that are selective for KCNA2- containing potassium channels suggests that in Purkinje cells, dendritic subthreshold KCNA2-containing potassium channels prevent random spontaneous calcium spikes, suppressing dendritic hyperexcitability without hindering the generation of somatic action potentials, and thereby play an important role in motor coordination. Plays a role in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus. May function as down-stream effector for G protein- coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA). Contributes to the regulation of the axonal release of the neurotransmitter dopamine. Reduced KCNA2 expression plays a role in the perception of neuropathic pain after peripheral nerve injury, but not acute pain. Plays a role in the regulation of the time spent in non-rapid eye movement (NREM) sleep. {, }.

    Click to Show/Hide
Taxonomy ID
10116
TCDB ID
. ; .
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Rodentia
Family: Muridae
Genus: Rattus
Species: Rattus norvegicus
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Potassium channel toxin Bgk (K25[Dab]) . . [1]
 Toxin Info    Potassium channel toxin Bgk (K25[Dap]) . . [1]
 Toxin Info    Potassium channel toxin Bgk (K25[Nle]) . . [1]
 Toxin Info    Potassium channel toxin Bgk (K25[Orn]) Dissociation constant
0.38 nM
[1]
 Toxin Info    Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin Dissociation constant
0.74 nM
[2], [3], [4], [5]
 Toxin Info    Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin Dissociation constant
1.7 nM
[2], [3], [4], [5]
 Toxin Info    Toxin II.10.4 (7TP,D9Q) Dissociation constant
1.9 nM
[6]
 Toxin Info    Potassium channel toxin alpha-KTx 2.1 Dissociation constant
2 nM
[7], [8], [9]
 Toxin Info    Potassium channel toxin alpha-KTx 2.1 Dissociation constant
2 nM
[7], [8], [9], [10]
 Toxin Info    Potassium channel toxin alpha-KTx 3.2 Dissociation constant
3.4 nM
[11- 15]
 Toxin Info    Potassium channel toxin alpha-KTx 1.1 Dissociation constant
9 nM
[11- 31]
 Toxin Info    Potassium channel toxin alpha-KTx 1.1 Dissociation constant
10 nM
[11- 31]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 Dissociation constant
20 nM
[13- 34]
 Toxin Info    Potassium channel toxin alpha-KTx 10.1 Dissociation constant
27 nM
[6- 35]
 Toxin Info    Potassium channel toxin ShK ([pTyr],[AEEA]) Dissociation constant
48 nM
[36]
 Toxin Info    Potassium channel toxin alpha-KTx 13.2 Dissociation constant
97 nM
[37]
 Toxin Info    PBTx1 Dissociation constant
100 nM
[38]
 Toxin Info    ChTX (K32[Cpa]) Dissociation constant
363 nM
[39]
 Toxin Info    ChTX (K32D) Dissociation constant
498 nM
[39]
 Toxin Info    Potassium channel toxin alpha-KTx 1.10 Dissociation constant
547 nM
[43], [44], [45]
 Toxin Info    ChTX (K32E) Dissociation constant
703 nM
[39]
 Toxin Info    Potassium channel toxin alpha-KTx 11.1 Dissociation constant
1 μM
[38- 47]
 Toxin Info    Potassium channel toxin Bgk (K25A,Y26A) Dissociation constant
30 μM
[1]
 Toxin Info    Potassium channel toxin kappa-KTx 1.2 Dissociation constant
150 μM
[48- 52]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 Inhibition constant
0.5 nM
[45- 57]
 Toxin Info    Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin Inhibition constant
0.6 nM
[2], [3], [4], [5]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 Inhibition constant
1.1 nM
[45- 57]
 Toxin Info    Kunitz-type serine protease inhibitor homolog dendrotoxin K Inhibition constant
2 nM
[58- 64]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 Inhibition constant
2.3 nM
[13- 34]
 Toxin Info    Potassium channel toxin alpha-KTx 3.4 Inhibition constant
3.5 nM
[11- 65]
 Toxin Info    Potassium channel toxin alpha-KTx 3.4 Inhibition constant
4.5 nM
[11- 65]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 Inhibition constant
6.3 nM
[13- 34]
 Toxin Info    N.vectensis toxin 4 Effect . [66]
 Toxin Info    N.vectensis toxin 5 Effect . [66]
 Toxin Info    Mu-conotoxin CnIIIC Inhibition rate . [67], [68], [69]
 Toxin Info    Jingzhaotoxin F7-15.33 Inhibition rate . [70]
 Toxin Info    Kunitz-type serine protease inhibitor homolog dendrotoxin K Inhibition rate . [60]
 Toxin Info    Mu-conotoxin GIIIA Inhibition rate . [71- 83]
 Toxin Info    Toxin PhcrTx2 Inhibition rate . [84]
 Toxin Info    Apamin Inhibition rate . [40- 101]
 Toxin Info    Potassium channel toxin alpha-KTx 3.11 Inhibition rate . [102]
 Toxin Info    Mu-theraphotoxin-Pspp1 Inhibition rate . [103]
 Toxin Info    Mu-conotoxin PIIIA Inhibition rate . [67- 107]
 Toxin Info    Mu-conotoxin SIIIA Inhibition rate . [67- 132]
 Toxin Info    Potassium channel toxin alpha-KTx 15.2 Inhibition rate . [133]
 Toxin Info    Potassium channel toxin alpha-KTx 19.1 Inhibition rate . [134]
 Toxin Info    Potassium channel toxin alpha-KTx 6.3 Inhibition rate . [135]
 Toxin Info    Potassium channel toxin alpha-KTx 8.2 Inhibition rate . [136]
 Toxin Info    Potassium channel toxin kappa-KTx 1.3 Inhibition rate . [51]
 Toxin Info    Kappa-hefutoxin 2 Inhibition rate . [49]
 Toxin Info    Kappa-HfTx2 (C1A,T2C,A3Y,S4R,K5N,Q6C,C7W,W8R,P9E,V10G,C11N,N12D,Q13E,M14E,F15T,G16C,P18E,N19R,G20C) Inhibition rate . [49]
 Toxin Info    Potassium channel toxin alpha-KTx 8.6 Inhibition rate . [136], [137]
 Toxin Info    Potassium channel toxin alpha-KTx 8.6 Inhibition rate . [136]
 Toxin Info    Potassium channel toxin kappa-KTx 2.5 Inhibition rate . [138]
 Toxin Info    Potassium channel toxin TsTXK-beta Inhibition rate . [139]
 Toxin Info    Potassium channel toxin alpha-KTx 16.4 Inhibition rate . [140]
 Toxin Info    Neurotoxin lambda-MeuTx Inhibition rate . [141]
 Toxin Info    KappaPI-actitoxin-Ael3a Inhibition rate . [142], [143]
 Toxin Info    Peptide 401 (I1H,,fLys,2A,N4Y,C5R,K6N,R7C,H8W,V9R,I10E,K11G,P12N,H13D,I14E,C15E,R16T,,fLys,17C,I18K,C19E,G20R,,fLys,21C) Inhibition rate . [49]
 Toxin Info    Potassium channel toxin Bgk (K25A) Inhibition rate
2 %
[1]
 Toxin Info    Potassium channel toxin Bgk (F6A) Inhibition rate
3 %
[1]
 Toxin Info    Peptide TsPep3 Inhibition rate
5 %
[53- 145]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.2 Inhibition rate
5 %
[53- 146]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.2 Inhibition rate
5 %
[146]
 Toxin Info    Potassium channel toxin MeuTXKalpha3 Inhibition rate
6 %
[147]
 Toxin Info    Potassium channel toxin kappa-KTx 2.3 Inhibition rate
8 %
[148]
 Toxin Info    Potassium channel toxin Bgk (Y26A) Inhibition rate
9 %
[1]
 Toxin Info    Potassium channel toxin kappa-KTx 2.2 Inhibition rate
10 %
[148]
 Toxin Info    Potassium channel toxin Bgk (R12A) Inhibition rate
14 %
[1]
 Toxin Info    Potassium channel toxin kappa-KTx 2.2 Inhibition rate
14 %
[148]
 Toxin Info    Potassium channel toxin Bgk (H13A) Inhibition rate
17 %
[1]
 Toxin Info    Potassium channel toxin Bgk (S23A) Inhibition rate
17 %
[1]
 Toxin Info    Potassium channel toxin alpha-KTx 3.2 (K19S) Inhibition rate
19 %
[149]
 Toxin Info    Pi-stichotoxin-Hcr5b Inhibition rate
20 %
[150]
 Toxin Info    Calcium channel toxin-like peptide-1 Inhibition rate
25 %
[141]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.1 Inhibition rate
25 %
[146]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.1 Inhibition rate
25 %
[53- 151]
 Toxin Info    Potassium channel toxin Bgk (R27A) Inhibition rate
26 %
[1]
 Toxin Info    Potassium channel toxin Bgk (R3A) Inhibition rate
27 %
[1]
 Toxin Info    Potassium channel toxin alpha-KTx (N30P) Inhibition rate
29 %
[147]
 Toxin Info    Potassium channel toxin Bgk (N29A) Inhibition rate
33 %
[1]
 Toxin Info    Potassium channel toxin Bgk (L36A) Inhibition rate
34 %
[1]
 Toxin Info    Potassium channel toxin Bgk (R21A) Inhibition rate
34 %
[1]
 Toxin Info    Potassium channel toxin Bgk (N19A) Inhibition rate
40 %
[1]
 Toxin Info    Potassium channel toxin Bgk (W5A) Inhibition rate
45 %
[1]
 Toxin Info    Potassium channel toxin Bgk (T33A) Inhibition rate
46 %
[1]
 Toxin Info    Potassium channel toxin Bgk (K15A) Inhibition rate
52 %
[1]
 Toxin Info    Potassium channel toxin Bgk (K7A) Inhibition rate
52 %
[1]
 Toxin Info    Potassium channel toxin Bgk (K32A) Inhibition rate
55 %
[1]
 Toxin Info    Potassium channel toxin Bgk (L17A) Inhibition rate
62 %
[1]
 Toxin Info    Potassium channel toxin Bgk (Q24A) Inhibition rate
63 %
[1]
 Toxin Info    Potassium channel toxin Bgk (S16A) Inhibition rate
65 %
[1]
 Toxin Info    Kappa-conotoxin SrXIA Inhibition rate
66 %
[152], [153]
 Toxin Info    Kunitz-type conkunitzin-S1 Inhibition rate
70 %
[154], [155], [156]
 Toxin Info    Potassium channel toxin alpha-KTx 3.6 Inhibition rate
73 %
[157]
 Toxin Info    Potassium channel toxin Bgk (T22A) Inhibition rate
80 %
[1]
 Toxin Info    Potassium channel toxin Bgk (E35A) Inhibition rate
85 %
[1]
 Toxin Info    Potassium channel toxin Bgk (T9A) Inhibition rate
85 %
[1]
 Toxin Info    Potassium channel toxin Bgk (V1A) Inhibition rate
85 %
[1]
 Toxin Info    Potassium channel toxin Bgk (E8A) Inhibition rate
86 %
[1]
 Toxin Info    Potassium channel toxin alpha-KTx 19.2 Inhibition rate
100 %
[158]
 Toxin Info    Potassium channel toxin alpha-KTx 31.1 Inhibition rate
100 %
[159]
 Toxin Info    Potassium channel toxin alpha-KTx 3.2 Inhibition rate
100 %
[160]
 Toxin Info    Potassium channel toxin alpha-KTx 3.7 Inhibition rate
100 %
[160]
 Toxin Info    Potassium channel toxin alpha-KTx 31.1 Inhibition rate
100 %
[159]
 Toxin Info    Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin Effective concentration 50
0.38 nM
[161]
 Toxin Info    Potassium channel toxin alpha-KTx 20.1 Effective concentration 50
102 nM
[162]
 Toxin Info    Potassium channel toxin alpha-KTx 6.4 IC50
8 pM
[163], [164], [165]
 Toxin Info    Kappa-actitoxin-Bcs3a IC50
0.03 nM
[166]
 Toxin Info    Kappa-actitoxin-Bcs3a IC50
0.03 nM
[166]
 Toxin Info    Toxin MeKTx11-3 (S37P) IC50
0.07 nM
[167]
 Toxin Info    MTX (K15Q,G34C) IC50
0.074 nM
[168]
 Toxin Info    Toxin MeKTx11-3 (V9G) IC50
0.09 nM
[167]
 Toxin Info    MTX (S1A) IC50
0.13 nM
[169]
 Toxin Info    AgTx2 (R24A) IC50
0.14 nM
[12]
 Toxin Info    MTX (G33A) IC50
0.142 nM
[168]
 Toxin Info    Potassium channel toxin alpha-KTx 1.16 IC50
0.19 nM
[137- 167]
 Toxin Info    Potassium channel toxin alpha-KTx 1.16 IC50
0.19 nM
[167]
 Toxin Info    Potassium channel toxin alpha-KTx 6.1 IC50
0.44 nM
[170- 177]
 Toxin Info    MTX (P12A,P20A,G34C) IC50
0.68 nM
[178]
 Toxin Info    Potassium channel toxin alpha-KTx 6.2 IC50
0.8 nM
[12- 184]
 Toxin Info    MTX (C19[Abu],C34[Abu]) IC50
1.7 nM
[185]
 Toxin Info    Potassium channel toxin alpha-KTx 9.5 IC50
2.5 nM
[186]
 Toxin Info    Pi1 (C20[Abu],[Abu]) IC50
3 nM
[177]
 Toxin Info    Potassium channel toxin alpha-KTx 1.17 IC50
3.1 nM
[167]
 Toxin Info    Potassium channel toxin alpha-KTx 1.17 IC50
3.1 nM
[137- 167]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 IC50
4.4 nM
[13- 34]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 IC50
6 nM
[13- 34]
 Toxin Info    Potassium channel toxin alpha-KTx 12.2 IC50
6.19 nM
[187], [188]
 Toxin Info    Potassium channel toxin alpha-KTx 12.1 IC50
6.19 nM
[53- 194]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 IC50
6.4 nM
[13- 34]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 IC50
7 nM
[13- 34]
 Toxin Info    Potassium channel toxin alpha-KTx 3.13 IC50
8.92 nM
[157]
 Toxin Info    Potassium channel toxin alpha-KTx 3.13 IC50
8.92 nM
[157]
 Toxin Info    Potassium channel toxin alpha-KTx 3.4 IC50
9 nM
[11- 65]
 Toxin Info    Kappa-stichotoxin-She3a IC50
9 nM
[36- 208]
 Toxin Info    Kappa-stichotoxin-Hmg1a IC50
10 nM
[143- 210]
 Toxin Info    Potassium channel toxin alpha-KTx 3.12 IC50
10.4 nM
[211]
 Toxin Info    MeuKTx (G11R,G30R,D33H) IC50
10.7 nM
[212- 231]
 Toxin Info    Potassium channel toxin alpha-KTx 3.1 IC50
11 nM
[13- 34]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 IC50
11 nM
[45- 57]
 Toxin Info    Potassium channel toxin alpha-KTx 3.4 IC50
12 nM
[11- 65]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 IC50
12 nM
[45- 57]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 IC50
14 nM
[45- 57]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 IC50
15 nM
[45- 57]
 Toxin Info    Mesomartoxin IC50
15.6 nM
[232]
 Toxin Info    Mesomartoxin IC50
15.6 nM
[232]
 Toxin Info    Potassium channel toxin alpha-KTx 6.15 IC50
16 nM
[233]
 Toxin Info    Potassium channel toxin alpha-KTx 6.15 IC50
16 nM
[233]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 IC50
17 nM
[45- 57]
 Toxin Info    Potassium channel toxin alpha-KTx 3.4 IC50
20 nM
[11- 65]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) IC50
39 nM
[203]
 Toxin Info    Pi1 (R5A,R12A) IC50
67 nM
[175]
 Toxin Info    Pi1 (Y33[pTyr]) IC50
75 nM
[175]
 Toxin Info    Kappa-actitoxin-Bcs3b IC50
80.4 nM
[166]
 Toxin Info    Kappa-actitoxin-Bcs3b IC50
80.4 nM
[166]
 Toxin Info    Tst26 (Q19E,A20C) IC50
100 nM
[234]
 Toxin Info    Potassium channel toxin alpha-KTx 3.19 IC50
106 nM
[235]
 Toxin Info    Kappa-actitoxin-Avd6a IC50
140 nM
[143- 236]
 Toxin Info    Kappa-actitoxin-Ate1a IC50
146 nM
[237]
 Toxin Info    Potassium channel toxin alpha-KTx 12.1 IC50
165 nM
[53- 194]
 Toxin Info    Potassium channel toxin AbeTx1 IC50
167 nM
[238]
 Toxin Info    Kappa-actitoxin-Bcs4a IC50
172.59 nM
[239]
 Toxin Info    Kappa-actitoxin-Bcs4a IC50
172.59 nM
[239]
 Toxin Info    Potassium channel toxin alpha-KTx 8.5 IC50
183 nM
[240]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 IC50
196 nM
[53- 242]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 IC50
196 nM
[53- 242]
 Toxin Info    Toxin MeKTx13-3 (Q12A,K15A,K18A,D33R) IC50
208 nM
[235]
 Toxin Info    Potassium channel toxin alpha-KTx 8.8 IC50
331 nM
[243]
 Toxin Info    Potassium channel toxin alpha-KTx 8.8 IC50
331 nM
[243]
 Toxin Info    Pi1 (K31A) IC50
383 nM
[175]
 Toxin Info    Crotamine IC50
386 nM
[244- 260]
 Toxin Info    Potassium channel toxin alpha-KTx 9.2 IC50
530 nM
[261], [262], [263]
 Toxin Info    Plant defensin 2.3 (G36N) IC50
611 nM
[264]
 Toxin Info    Pi1 (R5A,K31A) IC50
623 nM
[175]
 Toxin Info    TstBut IC50
919 nM
[169]
 Toxin Info    KappaPI-actitoxin-Avd3c IC50
1.1 μM
[143- 236]
 Toxin Info    KappaPI-actitoxin-Avd3d IC50
1.3 μM
[143- 236]
 Toxin Info    Defensin-like protein 1 IC50
1.3 μM
[264]
 Toxin Info    Plant defensin 2.3 (K33A,G36N) IC50
1.38 μM
[264]
 Toxin Info    U-actitoxin-Oulsp1 IC50
1.778 μM
[265]
 Toxin Info    Plant defensin 2.3 (K33A) IC50
2.039 μM
[264]
 Toxin Info    Potassium channel toxin alpha-KTx 3.18 IC50
2.6777 μM
[212- 231]
 Toxin Info    KappaPI-actitoxin-Avd3b IC50
2.8 μM
[143- 236]
 Toxin Info    Potassium channel toxin alpha-KTx 9.1 IC50
4.4 μM
[47- 266]
 Toxin Info    Pi1 (K24A,Y33A) IC50
22 μM
[175]
 Toxin Info    Kappa-hefutoxin 3 (E20K) IC50
36.8 μM
[51]
 Toxin Info    Kappa-hefutoxin 3 (K20E) IC50
36.9 μM
[51]
References
Ref 1 Mapping the functional anatomy of BgK on Kv1.1, Kv1.2, and Kv1.3. Clues to design analogs with enhanced selectivity. J Biol Chem. 1999 Dec 10;274(50):35653-61. doi: 10.1074/jbc.274.50.35653.
Ref 2 Snake venoms. The amino acid sequences of two proteinase inhibitor homologues from Dendroaspis angusticeps venom. Hoppe Seylers Z Physiol Chem. 1980 May;361(5):661-74. doi: 10.1515/bchm2.1980.361.1.661.
Ref 3 Twenty years of dendrotoxins. Toxicon. 2001 Jan;39(1):15-26. doi: 10.1016/s0041-0101(00)00162-8.
Ref 4 Protease inhibitors from marine venomous animals and their counterparts in terrestrial venomous animals. Mar Drugs. 2013 Jun 14;11(6):2069-112. doi: 10.3390/md11062069.
Ref 5 Crystal structure of alpha-dendrotoxin from the green mamba venom and its comparison with the structure of bovine pancreatic trypsin inhibitor. J Mol Biol. 1992 Apr 5;224(3):671-83. doi: 10.1016/0022-2836(92)90552-u.
Ref 6 Cobatoxin 1 from Centruroides noxius scorpion venom: chemical synthesis, three-dimensional structure in solution, pharmacology and docking on K+ channels. Biochem J. 2004 Jan 1;377(Pt 1):37-49. doi: 10.1042/BJ20030977.
Ref 7 Charybdotoxin and noxiustoxin, two homologous peptide inhibitors of the K+ (Ca2+) channel. FEBS Lett. 1988 Jan 4;226(2):280-4. doi: 10.1016/0014-5793(88)81439-x.
Ref 8 Synthetic peptides corresponding to the sequence of noxiustoxin indicate that the active site of this K+ channel blocker is located on its amino-terminal portion. J Neural Transm. 1989;77(1):11-20. doi: 10.1007/BF01255815.
Ref 9 Determination of the three-dimensional solution structure of noxiustoxin: analysis of structural differences with related short-chain scorpion toxins. Biochemistry. 1995 Dec 26;34(51):16563-73. doi: 10.1021/bi00051a004.
Ref 10 Pharmacological characterization of five cloned voltage-gated K+ channels, types Kv1.1, 1.2, 1.3, 1.5, and 3.1, stably expressed in mammalian cell lines. Mol Pharmacol. 1994 Jun;45(6):1227-34.
Ref 11 Purification and characterization of three inhibitors of voltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom. Biochemistry. 1994 Jun 7;33(22):6834-9. doi: 10.1021/bi00188a012.
Ref 12 Chemical synthesis and 1H-NMR 3D structure determination of AgTx2-MTX chimera, a new potential blocker for Kv1.2 channel, derived from MTX and AgTx2 scorpion toxins. Protein Sci. 2008 Jan;17(1):107-18. doi: 10.1110/ps.073122908. Epub 2007 Nov 27.
Ref 13 A designer ligand specific for Kv1.3 channels from a scorpion neurotoxin-based library. Proc Natl Acad Sci U S A. 2009 Dec 29;106(52):22211-6. doi: 10.1073/pnas.0910123106. Epub 2009 Dec 10.
Ref 14 Scorpion toxins interact with nicotinic acetylcholine receptors. FEBS Lett. 2019 Oct;593(19):2779-2789. doi: 10.1002/1873-3468.13530. Epub 2019 Jul 18.
Ref 15 Solution structure of the potassium channel inhibitor agitoxin 2: caliper for probing channel geometry. Protein Sci. 1995 Aug;4(8):1478-89. doi: 10.1002/pro.5560040805.
Ref 16 Dynamic diversification from a putative common ancestor of scorpion toxins affecting sodium, potassium, and chloride channels. J Mol Evol. 1999 Feb;48(2):187-96. doi: 10.1007/pl00006457.
Ref 17 Purification, sequence, and model structure of charybdotoxin, a potent selective inhibitor of calcium-activated potassium channels. Proc Natl Acad Sci U S A. 1988 May;85(10):3329-33. doi: 10.1073/pnas.85.10.3329.
Ref 18 Charybdotoxin is a new member of the K+ channel toxin family that includes dendrotoxin I and mast cell degranulating peptide. Biochemistry. 1989 Dec 12;28(25):9708-14. doi: 10.1021/bi00451a025.
Ref 19 Analysis of the blocking activity of charybdotoxin homologs and iodinated derivatives against Ca2+-activated K+ channels. J Membr Biol. 1989 Aug;109(3):269-81. doi: 10.1007/BF01870284.
Ref 20 Solution synthesis of charybdotoxin (ChTX), a K+ channel blocker. Biochem Biophys Res Commun. 1990 Jul 31;170(2):684-90. doi: 10.1016/0006-291x(90)92145-p.
Ref 21 BeKm-1 is a HERG-specific toxin that shares the structure with ChTx but the mechanism of action with ErgTx1. Biophys J. 2003 May;84(5):3022-36. doi: 10.1016/S0006-3495(03)70028-9.
Ref 22 Maurotoxin: a potent inhibitor of intermediate conductance Ca2+-activated potassium channels. Mol Pharmacol. 2003 Feb;63(2):409-18. doi: 10.1124/mol.63.2.409.
Ref 23 Multidimensional signatures in antimicrobial peptides. Proc Natl Acad Sci U S A. 2004 May 11;101(19):7363-8. doi: 10.1073/pnas.0401567101. Epub 2004 Apr 26.
Ref 24 Scorpion Potassium Channel-blocking Defensin Highlights a Functional Link with Neurotoxin. J Biol Chem. 2016 Mar 25;291(13):7097-106. doi: 10.1074/jbc.M115.680611. Epub 2016 Jan 27.
Ref 25 Molecular structure of charybdotoxin, a pore-directed inhibitor of potassium ion channels. Science. 1990 Aug 3;249(4968):521-4. doi: 10.1126/science.1696395.
Ref 26 Molecular structure of charybdotoxin: retraction. Science. 1991 May 3;252(5006):631. doi: 10.1126/science.252.5006.631.b.
Ref 27 Three-dimensional structure of natural charybdotoxin in aqueous solution by 1H-NMR. Charybdotoxin possesses a structural motif found in other scorpion toxins. Eur J Biochem. 1991 Feb 26;196(1):19-28. doi: 10.1111/j.1432-1033.1991.tb15780.x.
Ref 28 Refined structure of charybdotoxin: common motifs in scorpion toxins and insect defensins. Science. 1991 Dec 6;254(5037):1521-3. doi: 10.1126/science.1720574.
Ref 29 Analysis of side-chain organization on a refined model of charybdotoxin: structural and functional implications. Biochemistry. 1992 Sep 1;31(34):7756-64. doi: 10.1021/bi00149a003.
Ref 30 Progress in multidimensional NMR investigations of peptide and protein 3-D structures in solution. From structure to functional aspects. Biochimie. 1992 Sep-Oct;74(9-10):825-36. doi: 10.1016/0300-9084(92)90065-m.
Ref 31 NMR solution structure of a two-disulfide derivative of charybdotoxin: structural evidence for conservation of scorpion toxin alpha/beta motif and its hydrophobic side chain packing. Biochemistry. 1997 Apr 1;36(13):3760-6. doi: 10.1021/bi962720h.
Ref 32 Kaliotoxin (1-37) shows structural differences with related potassium channel blockers. Biochemistry. 1994 Nov 29;33(47):14256-63. doi: 10.1021/bi00251a038.
Ref 33 A concept for rapid protein-structure determination by solid-state NMR spectroscopy. Angew Chem Int Ed Engl. 2005 Mar 29;44(14):2089-92. doi: 10.1002/anie.200462516.
Ref 34 Toxin-induced conformational changes in a potassium channel revealed by solid-state NMR. Nature. 2006 Apr 13;440(7086):959-62. doi: 10.1038/nature04649.
Ref 35 Cobatoxins 1 and 2 from Centruroides noxius Hoffmann constitute a subfamily of potassium-channel-blocking scorpion toxins. Eur J Biochem. 1998 Jun 15;254(3):468-79. doi: 10.1046/j.1432-1327.1998.2540468.x.
Ref 36 Targeting effector memory T cells with a selective peptide inhibitor of Kv1.3 channels for therapy of autoimmune diseases. Mol Pharmacol. 2005 Apr;67(4):1369-81. doi: 10.1124/mol.104.008193. Epub 2005 Jan 21.
Ref 37 OsK2, a new selective inhibitor of Kv1.2 potassium channels purified from the venom of the scorpion Orthochirus scrobiculosus. Biochem Biophys Res Commun. 2001 Sep 7;286(5):841-7. doi: 10.1006/bbrc.2001.5492.
Ref 38 A subfamily of acidic alpha-K(+) toxins. J Biol Chem. 2004 Jan 23;279(4):2781-9. doi: 10.1074/jbc.M311029200. Epub 2003 Oct 14.
Ref 39 Structure-guided transformation of charybdotoxin yields an analog that selectively targets Ca(2+)-activated over voltage-gated K(+) channels. J Biol Chem. 2000 Jan 14;275(2):1201-8. doi: 10.1074/jbc.275.2.1201.
Ref 40 The precursors of the bee venom constituents apamin and MCD peptide are encoded by two genes in tandem which share the same 3'-exon. J Biol Chem. 1995 May 26;270(21):12704-8. doi: 10.1074/jbc.270.21.12704.
Ref 41 Letter: An anti-inflammatory peptide from bee venom. Nature. 1973 Sep 21;245(5421):163-4. doi: 10.1038/245163a0.
Ref 42 Mast cell degranulating peptide: a multi-functional neurotoxin. J Pharm Pharmacol. 1990 Jul;42(7):457-61. doi: 10.1111/j.2042-7158.1990.tb06595.x.
Ref 43 Purification, characterization and biosynthesis of parabutoxin 3, a component of Parabuthus transvaalicus venom. Eur J Biochem. 2002 Apr;269(7):1854-65. doi: 10.1046/j.1432-1033.2002.02833.x.
Ref 44 Evidence for a function-specific mutation in the neurotoxin, parabutoxin 3. Eur J Neurosci. 2003 May;17(9):1786-92. doi: 10.1046/j.1460-9568.2003.02613.x.
Ref 45 A common "hot spot" confers hERG blockade activity to alpha-scorpion toxins affecting K+ channels. Biochem Pharmacol. 2008 Sep 15;76(6):805-15. doi: 10.1016/j.bcp.2008.07.008. Epub 2008 Jul 18.
Ref 46 A unified nomenclature for short-chain peptides isolated from scorpion venoms: alpha-KTx molecular subfamilies. Trends Pharmacol Sci. 1999 Nov;20(11):444-7. doi: 10.1016/s0165-6147(99)01398-x.
Ref 47 Structural and functional diversity of acidic scorpion potassium channel toxins. PLoS One. 2012;7(4):e35154. doi: 10.1371/journal.pone.0035154. Epub 2012 Apr 12.
Ref 48 kappa-Hefutoxin1, a novel toxin from the scorpion Heterometrus fulvipes with unique structure and function. Importance of the functional diad in potassium channel selectivity. J Biol Chem. 2002 Aug 16;277(33):30040-7. doi: 10.1074/jbc.M111258200. Epub 2002 May 28.
Ref 49 Synthesis and characterization of amino acid deletion analogs of -hefutoxin 1, a scorpion toxin on potassium channels. Toxicon. 2013 Sep;71:25-30. doi: 10.1016/j.toxicon.2013.05.010. Epub 2013 May 29.
Ref 50 Expanding the pharmacological profile of -hefutoxin 1 and analogues: A focus on the inhibitory effect on the oncogenic channel K(v)10.1. Peptides. 2017 Dec;98:43-50. doi: 10.1016/j.peptides.2016.08.008. Epub 2016 Aug 28.
Ref 51 Assignment of voltage-gated potassium channel blocking activity to kappa-KTx1.3, a non-toxic homologue of kappa-hefutoxin-1, from Heterometrus spinifer venom. Biochem Pharmacol. 2005 Feb 15;69(4):669-78. doi: 10.1016/j.bcp.2004.10.018. Epub 2004 Dec 29.
Ref 52 Screening, large-scale production and structure-based classification of cystine-dense peptides. Nat Struct Mol Biol. 2018 Mar;25(3):270-278. doi: 10.1038/s41594-018-0033-9. Epub 2018 Feb 26.
Ref 53 Novel components of Tityus serrulatus venom: A transcriptomic approach. Toxicon. 2021 Jan 15;189:91-104. doi: 10.1016/j.toxicon.2020.11.001. Epub 2020 Nov 10.
Ref 54 Tityustoxin K alpha blocks voltage-gated noninactivating K+ channels and unblocks inactivating K+ channels blocked by alpha-dendrotoxin in synaptosomes. Proc Natl Acad Sci U S A. 1994 Feb 15;91(4):1475-9. doi: 10.1073/pnas.91.4.1475.
Ref 55 Electrophysiological characterization of Ts6 and Ts7, K? channel toxins isolated through an improved Tityus serrulatus venom purification procedure. Toxins (Basel). 2014 Feb 28;6(3):892-913. doi: 10.3390/toxins6030892.
Ref 56 Tityustoxin-K(alpha) blockade of the voltage-gated potassium channel Kv1.3. Br J Pharmacol. 2003 Jul;139(6):1180-6. doi: 10.1038/sj.bjp.0705343.
Ref 57 Interaction of a toxin from the scorpion Tityus serrulatus with a cloned K+ channel from squid (sqKv1A). Biochemistry. 2001 May 22;40(20):5942-53. doi: 10.1021/bi010173g.
Ref 58 Cloning and functional expression of dendrotoxin K from black mamba, a K+ channel blocker. Biochemistry. 1993 Jun 1;32(21):5692-7. doi: 10.1021/bi00072a026.
Ref 59 Snake venom toxins. The amino acid sequence of toxin Vi2, a homologue of pancreatic trypsin inhibitor, from Dendroaspis polylepis polylepis (black mamba) venom. Biochim Biophys Acta. 1977 Apr 25;491(2):361-9. doi: 10.1016/0005-2795(77)90279-3.
Ref 60 Novel effects of dendrotoxin homologues on subtypes of mammalian Kv1 potassium channels expressed in Xenopus oocytes. FEBS Lett. 1996 Mar 25;383(1-2):26-30. doi: 10.1016/0014-5793(96)00211-6.
Ref 61 Site-directed mutagenesis of dendrotoxin K reveals amino acids critical for its interaction with neuronal K+ channels. Biochemistry. 1997 Jun 24;36(25):7690-6. doi: 10.1021/bi963105g.
Ref 62 The relative potencies of dendrotoxins as blockers of the cloned voltage-gated K+ channel, mKv1.1 (MK-1), when stably expressed in Chinese hamster ovary cells. Br J Pharmacol. 1997 Mar;120(6):1029-34. doi: 10.1038/sj.bjp.0701004.
Ref 63 Identification of residues in dendrotoxin K responsible for its discrimination between neuronal K+ channels containing Kv1.1 and 1.2 alpha subunits. Eur J Biochem. 1999 Jul;263(1):222-9. doi: 10.1046/j.1432-1327.1999.00494.x.
Ref 64 Nuclear magnetic resonance solution structure of dendrotoxin K from the venom of Dendroaspis polylepis polylepis. J Mol Biol. 1993 Dec 5;234(3):735-50. doi: 10.1006/jmbi.1993.1623.
Ref 65 Moving pieces in a taxonomic puzzle: venom 2D-LC/MS and data clustering analyses to infer phylogenetic relationships in some scorpions from the Buthidae family (Scorpiones). Toxicon. 2006 May;47(6):628-39. doi: 10.1016/j.toxicon.2006.01.015. Epub 2006 Mar 23.
Ref 66 The Birth and Death of Toxins with Distinct Functions: A Case Study in the Sea Anemone Nematostella. Mol Biol Evol. 2019 Sep 1;36(9):2001-2012. doi: 10.1093/molbev/msz132.
Ref 67 A novel -conopeptide, CnIIIC, exerts potent and preferential inhibition of NaV1.2/1.4 channels and blocks neuronal nicotinic acetylcholine receptors. Br J Pharmacol. 2012 Jul;166(5):1654-68. doi: 10.1111/j.1476-5381.2012.01837.x.
Ref 68 Large-scale discovery of conopeptides and conoproteins in the injectable venom of a fish-hunting cone snail using a combined proteomic and transcriptomic approach. J Proteomics. 2012 Sep 18;75(17):5215-25. doi: 10.1016/j.jprot.2012.06.001. Epub 2012 Jun 13.
Ref 69 Peptide therapeutics from venom: Current status and potential. Bioorg Med Chem. 2018 Jun 1;26(10):2738-2758. doi: 10.1016/j.bmc.2017.09.029. Epub 2017 Sep 23.
Ref 70 Jingzhaotoxin-X, a gating modifier of Kv4.2 and Kv4.3 potassium channels purified from the venom of the Chinese tarantula Chilobrachys jingzhao. J Venom Anim Toxins Incl Trop Dis. 2020 May 29;26:e20190043. doi: 10.1590/1678-9199-JVATITD-2019-0043.
Ref 71 Evolution of separate predation- and defence-evoked venoms in carnivorous cone snails. Nat Commun. 2014 Mar 24;5:3521. doi: 10.1038/ncomms4521.
Ref 72 Definition of the M-conotoxin superfamily: characterization of novel peptides from molluscivorous Conus venoms. Biochemistry. 2005 Jun 7;44(22):8176-86. doi: 10.1021/bi047541b.
Ref 73 The amino acid sequences of homologous hydroxyproline-containing myotoxins from the marine snail Conus geographus venom. FEBS Lett. 1983 May 8;155(2):277-80. doi: 10.1016/0014-5793(82)80620-0.
Ref 74 Disulfide pairings in geographutoxin I, a peptide neurotoxin from Conus geographus. FEBS Lett. 1990 May 7;264(1):29-32. doi: 10.1016/0014-5793(90)80756-9.
Ref 75 Action of derivatives of mu-conotoxin GIIIA on sodium channels. Single amino acid substitutions in the toxin separately affect association and dissociation rates. Biochemistry. 1992 Sep 8;31(35):8229-38. doi: 10.1021/bi00150a016.
Ref 76 Distinction among neuronal subtypes of voltage-activated sodium channels by mu-conotoxin PIIIA. J Neurosci. 2000 Jan 1;20(1):76-80. doi: 10.1523/JNEUROSCI.20-01-00076.2000.
Ref 77 Role of hydroxyprolines in the in vitro oxidative folding and biological activity of conotoxins. Biochemistry. 2008 Feb 12;47(6):1741-51. doi: 10.1021/bi701934m. Epub 2008 Jan 12.
Ref 78 Pruning nature: Biodiversity-derived discovery of novel sodium channel blocking conotoxins from Conus bullatus. Toxicon. 2009 Jan;53(1):90-8. doi: 10.1016/j.toxicon.2008.10.017. Epub 2008 Nov 20.
Ref 79 -Conotoxins that differentially block sodium channels NaV1.1 through 1.8 identify those responsible for action potentials in sciatic nerve. Proc Natl Acad Sci U S A. 2011 Jun 21;108(25):10302-7. doi: 10.1073/pnas.1107027108. Epub 2011 Jun 7.
Ref 80 NMR Structure of -Conotoxin GIIIC: Leucine 18 Induces Local Repacking of the N-Terminus Resulting in Reduced Na(V) Channel Potency. Molecules. 2018 Oct 22;23(10):2715. doi: 10.3390/molecules23102715.
Ref 81 Solution structure of mu-conotoxin GIIIA analysed by 2D-NMR and distance geometry calculations. FEBS Lett. 1991 Jan 28;278(2):160-6. doi: 10.1016/0014-5793(91)80107-e.
Ref 82 Tertiary structure of conotoxin GIIIA in aqueous solution. Biochemistry. 1991 Jul 16;30(28):6908-16. doi: 10.1021/bi00242a014.
Ref 83 Structure-activity relationships of mu-conotoxin GIIIA: structure determination of active and inactive sodium channel blocker peptides by NMR and simulated annealing calculations. Biochemistry. 1992 Dec 22;31(50):12577-84. doi: 10.1021/bi00165a006.
Ref 84 PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer. Toxins (Basel). 2018 Feb 7;10(2):72. doi: 10.3390/toxins10020072.
Ref 85 The peptide components of bee venom. Eur J Biochem. 1976 Jan 15;61(2):369-76. doi: 10.1111/j.1432-1033.1976.tb10030.x.
Ref 86 Apamin as a selective blocker of the calcium-dependent potassium channel in neuroblastoma cells: voltage-clamp and biochemical characterization of the toxin receptor. Proc Natl Acad Sci U S A. 1982 Feb;79(4):1308-12. doi: 10.1073/pnas.79.4.1308.
Ref 87 Apamin, a blocker of the calcium-activated potassium channel, induces neurodegeneration of Purkinje cells exclusively. Brain Res. 1997 Dec 19;778(2):405-8. doi: 10.1016/s0006-8993(97)01165-7.
Ref 88 Determinants of apamin and d-tubocurarine block in SK potassium channels. J Biol Chem. 1997 Sep 12;272(37):23195-200. doi: 10.1074/jbc.272.37.23195.
Ref 89 Pharmacological characterization of small-conductance Ca(2+)-activated K(+) channels stably expressed in HEK 293 cells. Br J Pharmacol. 2000 Mar;129(5):991-9. doi: 10.1038/sj.bjp.0703120.
Ref 90 SK3 is an important component of K(+) channels mediating the afterhyperpolarization in cultured rat SCG neurones. J Physiol. 2001 Sep 1;535(Pt 2):323-34. doi: 10.1111/j.1469-7793.2001.00323.x.
Ref 91 Apamin interacts with all subtypes of cloned small-conductance Ca2+-activated K+ channels. Pflugers Arch. 2001 Jan;441(4):544-50. doi: 10.1007/s004240000447.
Ref 92 An amino acid outside the pore region influences apamin sensitivity in small conductance Ca2+-activated K+ channels. J Biol Chem. 2007 Feb 9;282(6):3478-86. doi: 10.1074/jbc.M607213200. Epub 2006 Dec 1.
Ref 93 Apamin reduces neuromuscular transmission by activating inhibitory muscarinic M(2) receptors on motor nerve terminals. Eur J Pharmacol. 2010 Jan 25;626(2-3):239-43. doi: 10.1016/j.ejphar.2009.09.064. Epub 2009 Oct 8.
Ref 94 Allosteric block of KCa2 channels by apamin. J Biol Chem. 2010 Aug 27;285(35):27067-27077. doi: 10.1074/jbc.M110.110072. Epub 2010 Jun 18.
Ref 95 The small neurotoxin apamin blocks not only small conductance Ca(2+) activated K(+) channels (SK type) but also the voltage dependent Kv1.3 channel. Eur Biophys J. 2017 Sep;46(6):517-523. doi: 10.1007/s00249-016-1196-0. Epub 2017 Jan 20.
Ref 96 Apamin inhibits TNF-- and IFN--induced inflammatory cytokines and chemokines via suppressions of NF-B signaling pathway and STAT in human keratinocytes. Pharmacol Rep. 2017 Oct;69(5):1030-1035. doi: 10.1016/j.pharep.2017.04.006. Epub 2017 Apr 18.
Ref 97 Apamin Suppresses LPS-Induced Neuroinflammatory Responses by Regulating SK Channels and TLR4-Mediated Signaling Pathways. Int J Mol Sci. 2020 Jun 17;21(12):4319. doi: 10.3390/ijms21124319.
Ref 98 Apamin from bee venom suppresses inflammation in a murine model of gouty arthritis. J Ethnopharmacol. 2020 Jul 15;257:112860. doi: 10.1016/j.jep.2020.112860. Epub 2020 Apr 11.
Ref 99 Antioxidative, Antiapoptotic, and Anti-Inflammatory Effects of Apamin in a Murine Model of Lipopolysaccharide-Induced Acute Kidney Injury. Molecules. 2020 Dec 3;25(23):5717. doi: 10.3390/molecules25235717.
Ref 100 Solution structure of apamin determined by nuclear magnetic resonance and distance geometry. Biochemistry. 1988 Nov 1;27(22):8491-8. doi: 10.1021/bi00422a029.
Ref 101 Binding and toxicity of apamin. Characterization of the active site. Eur J Biochem. 1991 Mar 28;196(3):639-45. doi: 10.1111/j.1432-1033.1991.tb15860.x.
Ref 102 OdK2, a Kv1.3 channel-selective toxin from the venom of the Iranian scorpion Odonthobuthus doriae. Toxicon. 2008 Jun 15;51(8):1424-30. doi: 10.1016/j.toxicon.2008.03.027. Epub 2008 Mar 29.
Ref 103 Chemical Synthesis, Proper Folding, Na(v) Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. doi: 10.3390/toxins11060367.
Ref 104 mu-Conotoxin PIIIA, a new peptide for discriminating among tetrodotoxin-sensitive Na channel subtypes. J Neurosci. 1998 Jun 15;18(12):4473-81. doi: 10.1523/JNEUROSCI.18-12-04473.1998.
Ref 105 Co-expression of Na(V) subunits alters the kinetics of inhibition of voltage-gated sodium channels by pore-blocking -conotoxins. Br J Pharmacol. 2013 Apr;168(7):1597-610. doi: 10.1111/bph.12051.
Ref 106 Structurally diverse -conotoxin PIIIA isomers block sodium channel NaV 1.4. Angew Chem Int Ed Engl. 2012 Apr 23;51(17):4058-61. doi: 10.1002/anie.201107011. Epub 2012 Mar 12.
Ref 107 Solution structure of mu-conotoxin PIIIA, a preferential inhibitor of persistent tetrodotoxin-sensitive sodium channels. J Biol Chem. 2002 Jul 26;277(30):27247-55. doi: 10.1074/jbc.M201611200. Epub 2002 May 2.
Ref 108 A novel conotoxin from Conus striatus, mu-SIIIA, selectively blocking rat tetrodotoxin-resistant sodium channels. Toxicon. 2006 Jan;47(1):122-32. doi: 10.1016/j.toxicon.2005.10.008. Epub 2005 Dec 1.
Ref 109 Novel conotoxins from Conus striatus and Conus kinoshitai selectively block TTX-resistant sodium channels. Biochemistry. 2005 May 17;44(19):7259-65. doi: 10.1021/bi0473408.
Ref 110 A Lewis Acid-Controlled Enantiodivergent Epoxidation of Aldehydes. ACS Catal. 2023 Oct 6;13(19):13117-13126. doi: 10.1021/acscatal.3c03929. Epub 2023 Sep 25.
Ref 111 Retraction of "Effect of Fluoride Layer Growth on the Deposition Rate under Different Microchannel Structures". ACS Omega. 2024 Feb 28;9(10):12291. doi: 10.1021/acsomega.4c01652. eCollection 2024 Mar 12.
Ref 112 Retraction of "Assessing the Weathering Performance and Functionality of Nanoparticle-Enhanced High-Pressure Laminates for Building Facade Applications". ACS Omega. 2024 Mar 1;9(10):12290. doi: 10.1021/acsomega.4c01411. eCollection 2024 Mar 12.
Ref 113 Correction to "Digoxin-Mediated Inhibition of Potential Hypoxia-Related Angiogenic Repair in Modulated Electro-Hyperthermia (mEHT)-Treated Murine Triple-Negative Breast Cancer Model". ACS Pharmacol Transl Sci. 2024 Feb 28;7(3):904. doi: 10.1021/acsptsci.4c00094. eCollection 2024 Mar 8.
Ref 114 Correction to 1,2,3-Triazole Tethered Hybrid Capsaicinoids as Antiproliferative Agents Active against Lung Cancer Cells (A549). ACS Omega. 2024 Feb 20;9(9):11026. doi: 10.1021/acsomega.4c00155. eCollection 2024 Mar 5.
Ref 115 Correction to "Dual-Surfactant-Capped Ag Nanoparticles as a Highly Selective and Sensitive Colorimetric Sensor for Citrate Detection". ACS Omega. 2024 Feb 22;9(9):11025. doi: 10.1021/acsomega.3c09929. eCollection 2024 Mar 5.
Ref 116 Colloidal Stability of PFSA-Ionomer Dispersions. Part I. Single-Ion Electrostatic Interaction Potential Energies. Langmuir. 2024 Apr 2;40(13):6654-6665. doi: 10.1021/acs.langmuir.3c03903. Epub 2024 Mar 8.
Ref 117 Correction to "Searching for the Rules of Electrochemical Nitrogen Fixation". ACS Catal. 2024 Feb 14;14(5):3169-3170. doi: 10.1021/acscatal.4c00448. eCollection 2024 Mar 1.
Ref 118 Correction to "Quantification and Mapping of Alkylation in the Human Genome Reveal Single Nucleotide Resolution Precursors of Mutational Signatures". ACS Cent Sci. 2024 Jan 25;10(2):487. doi: 10.1021/acscentsci.3c01597. eCollection 2024 Feb 28.
Ref 119 Correction to "Characterization of Proteins Extracted from Ulva sp., Padina sp., and Laurencia sp. Macroalgae Using Green Technology: Effect of In Vitro Digestion on Antioxidant and ACE-I Inhibitory Activity". ACS Omega. 2024 Feb 16;9(8):9848. doi: 10.1021/acsomega.4c00407. eCollection 2024 Feb 27.
Ref 120 Erratum: Antibacterial Efficacy of ZnO/Bentonite (Clay) Nanocomposites against Multidrug-Resistant Escherichia coli. ACS Omega. 2024 Feb 15;9(8):9847. doi: 10.1021/acsomega.4c00630. eCollection 2024 Feb 27.
Ref 121 Low-Cost Nonfused-Ring Electron Acceptors Enabled by Noncovalent Conformational Locks. Acc Chem Res. 2024 Mar 19;57(6):981-991. doi: 10.1021/acs.accounts.3c00813. Epub 2024 Mar 3.
Ref 122 Retraction of "Hydrogenolysis of Polyethylene and Polypropylene into Propane over Cobalt-Based Catalysts". JACS Au. 2024 Feb 7;4(2):865. doi: 10.1021/jacsau.4c00090. eCollection 2024 Feb 26.
Ref 123 Correction to "Comprehensive Study of Preparation of Carboxy Group-Containing Cellulose Fibers from Dry-Lap Kraft Pulps by Catalytic Oxidation with Solid NaOCl". ACS Sustain Chem Eng. 2024 Feb 6;12(7):2921-2923. doi: 10.1021/acssuschemeng.4c00215. eCollection 2024 Feb 19.
Ref 124 Correction to "Dissolution Behavior of Polycyclic Aromatic Hydrocarbons in Heavy Oil in the Presence of Supercritical Cyclohexane". ACS Omega. 2024 Jan 31;9(6):7269. doi: 10.1021/acsomega.4c00064. eCollection 2024 Feb 13.
Ref 125 Retraction of "Fe(3)O(4) Nanoparticles Grown on Cellulose/GO Hydrogels as Advanced Catalytic Materials for the Heterogeneous Fenton-like Reaction". ACS Omega. 2024 Jan 31;9(6):7270. doi: 10.1021/acsomega.4c00561. eCollection 2024 Feb 13.
Ref 126 Correction to "Ligand Chromophore Modification Approach for Predictive Incremental Tuning of Metal-Organic Framework Color". Chem Mater. 2024 Jan 19;36(3):1773. doi: 10.1021/acs.chemmater.3c03160. eCollection 2024 Feb 13.
Ref 127 Correction to "Electrospun Nanofibrous UV Filters with Bidirectional Actuation Properties Based on Salmon Sperm DNA/Silk Fibroin for Biomedical Applications". ACS Omega. 2024 Jan 25;9(5):6025. doi: 10.1021/acsomega.4c00072. eCollection 2024 Feb 6.
Ref 128 Correction to "Iterative Dual-Metal and Energy Transfer Catalysis Enables Stereodivergence in Alkyne Difunctionalization: Carboboration as Case Study". ACS Catal. 2024 Jan 22;14(3):1976. doi: 10.1021/acscatal.4c00200. eCollection 2024 Feb 2.
Ref 129 Correction to "Nanotechnology Impact on Chemical-Enhanced Oil Recovery: A Review and Bibliometric Analysis of Recent Developments". ACS Omega. 2024 Jan 15;9(4):5083. doi: 10.1021/acsomega.3c10450. eCollection 2024 Jan 30.
Ref 130 Neuronally micro-conotoxins from Conus striatus utilize an alpha-helical motif to target mammalian sodium channels. J Biol Chem. 2008 Aug 1;283(31):21621-8. doi: 10.1074/jbc.M802852200. Epub 2008 Jun 3.
Ref 131 N- and C-terminal extensions of -conotoxins increase potency and selectivity for neuronal sodium channels. Biopolymers. 2012;98(2):161-5. doi: 10.1002/bip.22032. Epub 2012 Feb 10.
Ref 132 Structure, dynamics, and selectivity of the sodium channel blocker mu-conotoxin SIIIA. Biochemistry. 2008 Oct 14;47(41):10940-9. doi: 10.1021/bi801010u. Epub 2008 Sep 18.
Ref 133 BmTx3, a scorpion toxin with two putative functional faces separately active on A-type K+ and HERG currents. Biochem J. 2004 Mar 15;378(Pt 3):745-52. doi: 10.1042/BJ20031324.
Ref 134 BmBKTx1, a novel Ca2+-activated K+ channel blocker purified from the Asian scorpion Buthus martensi Karsch. J Biol Chem. 2004 Aug 13;279(33):34562-9. doi: 10.1074/jbc.M312798200. Epub 2004 Jun 3.
Ref 135 Evidence for domain-specific recognition of SK and Kv channels by MTX and HsTx1 scorpion toxins. J Biol Chem. 2004 Dec 31;279(53):55690-6. doi: 10.1074/jbc.M410055200. Epub 2004 Oct 21.
Ref 136 Molecular diversity and functional evolution of scorpion potassium channel toxins. Mol Cell Proteomics. 2011 Feb;10(2):M110.002832. doi: 10.1074/mcp.M110.002832. Epub 2010 Sep 30.
Ref 137 Variability of Potassium Channel Blockers in Mesobuthus eupeus Scorpion Venom with Focus on Kv1.1: AN INTEGRATED TRANSCRIPTOMIC AND PROTEOMIC STUDY. J Biol Chem. 2015 May 8;290(19):12195-209. doi: 10.1074/jbc.M115.637611. Epub 2015 Mar 19.
Ref 138 The new kappa-KTx 2.5 from the scorpion Opisthacanthus cayaporum. Peptides. 2011 Jul;32(7):1509-17. doi: 10.1016/j.peptides.2011.05.017. Epub 2011 May 23.
Ref 139 Ts8 scorpion toxin inhibits the Kv4.2 channel and produces nociception in?vivo. Toxicon. 2016 Sep 1;119:244-52. doi: 10.1016/j.toxicon.2016.06.014. Epub 2016 Jun 23.
Ref 140 Molecular divergence of two orthologous scorpion toxins affecting potassium channels. Comp Biochem Physiol A Mol Integr Physiol. 2011 Jul;159(3):313-21. doi: 10.1016/j.cbpa.2011.03.027. Epub 2011 Apr 3.
Ref 141 Functional evolution of scorpion venom peptides with an inhibitor cystine knot fold. Biosci Rep. 2013 Jun 27;33(3):e00047. doi: 10.1042/BSR20130052.
Ref 142 A bifunctional sea anemone peptide with Kunitz type protease and potassium channel inhibiting properties. Biochem Pharmacol. 2011 Jul 1;82(1):81-90. doi: 10.1016/j.bcp.2011.03.023. Epub 2011 Apr 6.
Ref 143 Development of a rational nomenclature for naming peptide and protein toxins from sea anemones. Toxicon. 2012 Sep 15;60(4):539-50. doi: 10.1016/j.toxicon.2012.05.020. Epub 2012 Jun 5.
Ref 144 Novel structural class of four disulfide-bridged peptides from Tityus serrulatus venom. Biochem Biophys Res Commun. 2003 Feb 21;301(4):1086-92. doi: 10.1016/s0006-291x(03)00082-2.
Ref 145 Tityus serrulatus scorpion venom and toxins: an overview. Protein Pept Lett. 2009;16(8):920-32. doi: 10.2174/092986609788923329.
Ref 146 Structural and Functional Elucidation of Peptide Ts11 Shows Evidence of a Novel Subfamily of Scorpion Venom Toxins. Toxins (Basel). 2016 Sep 30;8(10):288. doi: 10.3390/toxins8100288.
Ref 147 A single-point mutation enhances dual functionality of a scorpion toxin. Comp Biochem Physiol C Toxicol Pharmacol. 2016 Jan;179:72-8. doi: 10.1016/j.cbpc.2015.09.002. Epub 2015 Sep 7.
Ref 148 An unusual fold for potassium channel blockers: NMR structure of three toxins from the scorpion Opisthacanthus madagascariensis. Biochem J. 2005 May 15;388(Pt 1):263-71. doi: 10.1042/BJ20041705.
Ref 149 AgTx2-GFP, Fluorescent Blocker Targeting Pharmacologically Important K(v)1.x (x = 1, 3, 6) Channels. Toxins (Basel). 2023 Mar 18;15(3):229. doi: 10.3390/toxins15030229.
Ref 150 A Tale of Toxin Promiscuity: The Versatile Pharmacological Effects of Hcr 1b-2 Sea Anemone Peptide on Voltage-Gated Ion Channels. Mar Drugs. 2022 Feb 17;20(2):147. doi: 10.3390/md20020147.
Ref 151 Proteomic endorsed transcriptomic profiles of venom glands from Tityus obscurus and T. serrulatus scorpions. PLoS One. 2018 Mar 21;13(3):e0193739. doi: 10.1371/journal.pone.0193739. eCollection 2018.
Ref 152 I-conotoxins in vermivorous species of the West Atlantic: peptide sr11a from Conus spurius. Peptides. 2007 Jan;28(1):18-23. doi: 10.1016/j.peptides.2006.08.024. Epub 2006 Dec 12.
Ref 153 Peptide sr11a from Conus spurius is a novel peptide blocker for Kv1 potassium channels. Peptides. 2010 Jul;31(7):1287-91. doi: 10.1016/j.peptides.2010.04.007. Epub 2010 Apr 18.
Ref 154 Production of recombinant Conkunitzin-S1 in Escherichia coli. Protein Expr Purif. 2006 Jun;47(2):640-4. doi: 10.1016/j.pep.2006.01.019. Epub 2006 Feb 20.
Ref 155 Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family. Structural and functional characterization. J Biol Chem. 2005 Jun 24;280(25):23766-70. doi: 10.1074/jbc.C500064200. Epub 2005 Apr 15.
Ref 156 Structure of conkunitzin-S1, a neurotoxin and Kunitz-fold disulfide variant from cone snail. Acta Crystallogr D Biol Crystallogr. 2006 Sep;62(Pt 9):980-90. doi: 10.1107/S0907444906021123. Epub 2006 Aug 19.
Ref 157 A potent potassium channel blocker from Mesobuthus eupeus scorpion venom. Biochimie. 2010 Dec;92(12):1847-53. doi: 10.1016/j.biochi.2010.08.003. Epub 2010 Aug 14.
Ref 158 Characterization of Kbot21 Reveals Novel Side Chain Interactions of Scorpion Toxins Inhibiting Voltage-Gated Potassium Channels. PLoS One. 2015 Sep 23;10(9):e0137611. doi: 10.1371/journal.pone.0137611. eCollection 2015.
Ref 159 Kbot55, purified from Buthus occitanus tunetanus venom, represents the first member of a novel -KTx subfamily. Peptides. 2016 Jun;80:4-8. doi: 10.1016/j.peptides.2015.05.015. Epub 2015 Jun 14.
Ref 160 Fluorescent protein-scorpion toxin chimera is a convenient molecular tool for studies of potassium channels. Sci Rep. 2016 Sep 21;6:33314. doi: 10.1038/srep33314.
Ref 161 Identification of amino acid residues involved in dendrotoxin block of rat voltage-dependent potassium channels. Mol Pharmacol. 1991 Oct;40(4):572-6.
Ref 162 A novel toxin from the venom of the scorpion Tityus trivittatus, is the first member of a new alpha-KTX subfamily. FEBS Lett. 2006 Jan 23;580(2):592-6. doi: 10.1016/j.febslet.2005.12.073. Epub 2006 Jan 4.
Ref 163 Two similar peptides from the venom of the scorpion Pandinus imperator, one highly effective blocker and the other inactive on K+ channels. Toxicon. 1998 May;36(5):759-70. doi: 10.1016/s0041-0101(97)00163-3.
Ref 164 Synthesis and characterization of Pi4, a scorpion toxin from Pandinus imperator that acts on K+ channels. Eur J Biochem. 2003 Sep;270(17):3583-92. doi: 10.1046/j.1432-1033.2003.03743.x.
Ref 165 Solution structure of Pi4, a short four-disulfide-bridged scorpion toxin specific of potassium channels. Protein Sci. 2003 Sep;12(9):1844-54. doi: 10.1110/ps.03186703.
Ref 166 Biochemical and electrophysiological characterization of two sea anemone type 1 potassium toxins from a geographically distant population of Bunodosoma caissarum. Mar Drugs. 2013 Mar 6;11(3):655-79. doi: 10.3390/md11030655.
Ref 167 K(V)1.2 channel-specific blocker from Mesobuthus eupeus scorpion venom: Structural basis of selectivity. Neuropharmacology. 2018 Dec;143:228-238. doi: 10.1016/j.neuropharm.2018.09.030. Epub 2018 Sep 22.
Ref 168 Maurotoxin versus Pi1/HsTx1 scorpion toxins. Toward new insights in the understanding of their distinct disulfide bridge patterns. J Biol Chem. 2000 Dec 15;275(50):39394-402. doi: 10.1074/jbc.M006810200.
Ref 169 Increasing the molecular contacts between maurotoxin and Kv1.2 channel augments ligand affinity. Proteins. 2005 Aug 15;60(3):401-11. doi: 10.1002/prot.20509.
Ref 170 A novel structural class of K+-channel blocking toxin from the scorpion Pandinus imperator. Biochem J. 1996 May 1;315 ( Pt 3)(Pt 3):977-81. doi: 10.1042/bj3150977.
Ref 171 Block of ShakerB K+ channels by Pi1, a novel class of scorpion toxin. FEBS Lett. 1997 Jan 3;400(2):197-200. doi: 10.1016/s0014-5793(96)01387-7.
Ref 172 Pandinus imperator scorpion venom blocks voltage-gated K+ channels in human lymphocytes. Biochem Biophys Res Commun. 1998 Jan 26;242(3):621-5. doi: 10.1006/bbrc.1997.8018.
Ref 173 Chemical synthesis and characterization of Pi1, a scorpion toxin from Pandinus imperator active on K+ channels. Eur J Biochem. 2000 Aug;267(16):5149-55. doi: 10.1046/j.1432-1327.2000.01577.x.
Ref 174 Design and characterization of a highly selective peptide inhibitor of the small conductance calcium-activated K+ channel, SkCa2. J Biol Chem. 2001 Nov 16;276(46):43145-51. doi: 10.1074/jbc.M106981200. Epub 2001 Aug 29.
Ref 175 The 'functional' dyad of scorpion toxin Pi1 is not itself a prerequisite for toxin binding to the voltage-gated Kv1.2 potassium channels. Biochem J. 2004 Jan 1;377(Pt 1):25-36. doi: 10.1042/BJ20030115.
Ref 176 A novel potassium channel blocking toxin from the scorpion Pandinus imperator: A 1H NMR analysis using a nano-NMR probe. Biochemistry. 1997 Mar 4;36(9):2649-58. doi: 10.1021/bi9617116.
Ref 177 The impact of the fourth disulfide bridge in scorpion toxins of the alpha-KTx6 subfamily. Proteins. 2005 Dec 1;61(4):1010-23. doi: 10.1002/prot.20681.
Ref 178 Disulfide bridge reorganization induced by proline mutations in maurotoxin. FEBS Lett. 2001 Feb 2;489(2-3):202-7. doi: 10.1016/s0014-5793(00)02433-9.
Ref 179 Chemical synthesis and characterization of maurotoxin, a short scorpion toxin with four disulfide bridges that acts on K+ channels. Eur J Biochem. 1996 Dec 15;242(3):491-8. doi: 10.1111/j.1432-1033.1996.0491r.x.
Ref 180 Maurotoxin, a four disulfide bridge toxin from Scorpio maurus venom: purification, structure and action on potassium channels. FEBS Lett. 1997 Apr 14;406(3):284-90. doi: 10.1016/s0014-5793(97)00285-8.
Ref 181 Maurotoxin, a four disulfide bridges scorpion toxin acting on K+ channels. Toxicon. 1998 Nov;36(11):1609-11. doi: 10.1016/s0041-0101(98)00153-6.
Ref 182 Mechanisms of maurotoxin action on Shaker potassium channels. Biophys J. 2000 Aug;79(2):776-87. doi: 10.1016/S0006-3495(00)76335-1.
Ref 183 Effect of maurotoxin, a four disulfide-bridged toxin from the chactoid scorpion Scorpio maurus, on Shaker K+ channels. J Pept Res. 2000 Jun;55(6):419-27. doi: 10.1034/j.1399-3011.2000.00715.x.
Ref 184 Structural and functional consequences of the presence of a fourth disulfide bridge in the scorpion short toxins: solution structure of the potassium channel inhibitor HsTX1. Protein Sci. 1999 Dec;8(12):2672-85. doi: 10.1110/ps.8.12.2672.
Ref 185 Synthesis, 1H NMR structure, and activity of a three-disulfide-bridged maurotoxin analog designed to restore the consensus motif of scorpion toxins. J Biol Chem. 2000 May 5;275(18):13605-12. doi: 10.1074/jbc.275.18.13605.
Ref 186 Kbot1, a three disulfide bridges toxin from Buthus occitanus tunetanus venom highly active on both SK and Kv channels. Peptides. 2004 Apr;25(4):637-45. doi: 10.1016/j.peptides.2004.02.017.
Ref 187 Disulfide bridges and blockage of Shaker B K(+)-channels by another butantoxin peptide purified from the Argentinean scorpion Tityus trivittatus. Toxicon. 2003 Feb;41(2):173-9. doi: 10.1016/s0041-0101(02)00247-7.
Ref 188 NMR solution structure of butantoxin. Arch Biochem Biophys. 2000 Jul 1;379(1):18-27. doi: 10.1006/abbi.2000.1858.
Ref 189 TsTX-IV, a short chain four-disulfide-bridged neurotoxin from Tityus serrulatus venom which acts on Ca2+-activated K+ channels. Toxicon. 1999 Apr;37(4):651-60. doi: 10.1016/s0041-0101(98)00206-2.
Ref 190 Covalent structure and some pharmacological features of native and cleaved alpha-KTx12-1, a four disulfide-bridged toxin from Tityus serrulatus venom. J Pept Sci. 2003 Feb;9(2):132-40. doi: 10.1002/psc.440.
Ref 191 Influence of post-starvation extraction time and prey-specific diet in Tityus serrulatus scorpion venom composition and hyaluronidase activity. Toxicon. 2014 Nov;90:326-36. doi: 10.1016/j.toxicon.2014.08.064. Epub 2014 Sep 6.
Ref 192 Tityus serrulatus venom and toxins Ts1, Ts2 and Ts6 induce macrophage activation and production of immune mediators. Toxicon. 2011 Jun;57(7-8):1101-8. doi: 10.1016/j.toxicon.2011.04.017. Epub 2011 Apr 29.
Ref 193 Ts6 and Ts2 from Tityus serrulatus venom induce inflammation by mechanisms dependent on lipid mediators and cytokine production. Toxicon. 2013 Jan;61:1-10. doi: 10.1016/j.toxicon.2012.10.002. Epub 2012 Oct 22.
Ref 194 Probing the pH-dependent structural features of alpha-KTx12.1, a potassium channel blocker from the scorpion Tityus serrulatus. Protein Sci. 2005 Apr;14(4):1025-38. doi: 10.1110/ps.041131205.
Ref 195 Characterization of a potassium channel toxin from the Caribbean Sea anemone Stichodactyla helianthus. Toxicon. 1995 May;33(5):603-13. doi: 10.1016/0041-0101(95)00013-c.
Ref 196 Chemical synthesis and characterization of ShK toxin: a potent potassium channel inhibitor from a sea anemone. Int J Pept Protein Res. 1995 Nov;46(5):354-8. doi: 10.1111/j.1399-3011.1995.tb01068.x.
Ref 197 Identification of three separate binding sites on SHK toxin, a potent inhibitor of voltage-dependent potassium channels in human T-lymphocytes and rat brain. Biochem Biophys Res Commun. 1996 Feb 27;219(3):696-701. doi: 10.1006/bbrc.1996.0297.
Ref 198 Structural conservation of the pores of calcium-activated and voltage-gated potassium channels determined by a sea anemone toxin. J Biol Chem. 1999 Jul 30;274(31):21885-92. doi: 10.1074/jbc.274.31.21885.
Ref 199 Defensin-neurotoxin dyad in a basally branching metazoan sea anemone. FEBS J. 2017 Oct;284(19):3320-3338. doi: 10.1111/febs.14194. Epub 2017 Sep 6.
Ref 200 Development of a sea anemone toxin as an immunomodulator for therapy of autoimmune diseases. Toxicon. 2012 Mar 15;59(4):529-46. doi: 10.1016/j.toxicon.2011.07.016. Epub 2011 Aug 12.
Ref 201 Sea Anemones: Quiet Achievers in the Field of Peptide Toxins. Toxins (Basel). 2018 Jan 8;10(1):36. doi: 10.3390/toxins10010036.
Ref 202 Solution structure of ShK toxin, a novel potassium channel inhibitor from a sea anemone. Nat Struct Biol. 1996 Apr;3(4):317-20. doi: 10.1038/nsb0496-317.
Ref 203 ShK-Dap22, a potent Kv1.3-specific immunosuppressive polypeptide. J Biol Chem. 1998 Dec 4;273(49):32697-707. doi: 10.1074/jbc.273.49.32697.
Ref 204 Role of disulfide bonds in the structure and potassium channel blocking activity of ShK toxin. Biochemistry. 1999 Nov 2;38(44):14549-58. doi: 10.1021/bi991282m.
Ref 205 Engineering a stable and selective peptide blocker of the Kv1.3 channel in T lymphocytes. Mol Pharmacol. 2009 Apr;75(4):762-73. doi: 10.1124/mol.108.052704. Epub 2009 Jan 2.
Ref 206 Native chemical ligation at Asx-Cys, Glx-Cys: chemical synthesis and high-resolution X-ray structure of ShK toxin by racemic protein crystallography. J Am Chem Soc. 2013 Aug 14;135(32):11911-9. doi: 10.1021/ja4046795. Epub 2013 Aug 6.
Ref 207 Pharmaceutical Optimization of Peptide Toxins for Ion Channel Targets: Potent, Selective, and Long-Lived Antagonists of Kv1.3. J Med Chem. 2015 Sep 10;58(17):6784-802. doi: 10.1021/acs.jmedchem.5b00495. Epub 2015 Aug 31.
Ref 208 Inversion of the Side-Chain Stereochemistry of Indvidual Thr or Ile Residues in a Protein Molecule: Impact on the Folding, Stability, and Structure of the ShK Toxin. Angew Chem Int Ed Engl. 2017 Mar 13;56(12):3324-3328. doi: 10.1002/anie.201612398. Epub 2017 Feb 14.
Ref 209 A new potassium channel toxin from the sea anemone Heteractis magnifica: isolation, cDNA cloning, and functional expression. Biochemistry. 1997 Sep 23;36(38):11461-71. doi: 10.1021/bi970253d.
Ref 210 Genomic structure of a potassium channel toxin from Heteractis magnifica. FEBS Lett. 1997 Nov 24;418(1-2):183-8. doi: 10.1016/s0014-5793(97)01365-3.
Ref 211 A new Kaliotoxin selective towards Kv1.3 and Kv1.2 but not Kv1.1 channels expressed in oocytes. Biochem Biophys Res Commun. 2008 Nov 21;376(3):525-30. doi: 10.1016/j.bbrc.2008.09.033. Epub 2008 Sep 18.
Ref 212 Retraction: Role of mesenchymal stem cells versus angiotensin converting enzyme inhibitor in kidney repair. Nephrology (Carlton). 2024 Apr;29(4):239. doi: 10.1111/nep.14278. Epub 2024 Feb 11.
Ref 213 Photogeneration and quenching of singlet molecular oxygen by bacterial C(40) carotenoids with long chain of conjugated double bonds. Photosynth Res. 2024 Mar;159(2-3):291-301. doi: 10.1007/s11120-023-01070-6. Epub 2024 Feb 5.
Ref 214 Density Functional Theory, Molecular Dynamics and AlteQ Studies Approaches of Baimantuoluoamide A and Baimantuoluoamide B to Identify Potential Inhibitors of M(pro) Proteins: a Novel Target for the Treatment of SARS COVID-19. JETP Lett. 2023 May 15:1-10. doi: 10.1134/S0021364023600039. Online ahead of print.
Ref 215 Melatonin Confers NaCl Tolerance in Withaniacoagulans L. by Maintaining Na(+)/K(+) Homeostasis, Strengthening the Antioxidant Defense System and Modulating Withanolides Synthesis-Related Genes. Russ J Plant Physiol. 2023;70(3):52. doi: 10.1134/S1021443723600125. Epub 2023 May 23.
Ref 216 Rhodococcus rhodochrous IEGM 1360, an Effective Biocatalyst of C3 Oxidative Transformation of Oleanane Triterpenoids. Microbiology (N Y). 2023;92(2):204-214. doi: 10.1134/S0026261722603360. Epub 2023 Apr 21.
Ref 217 Quaternary Ammonium Salt Strategy and Molecular Docking Studies of Novel 5-Acyl-8-(Arylamino)-Quinolines by Acetyl and Methanesulfonyl Chloride for Dual Evaluation Bioactivity. Russ J Bioorg Chem. 2023;49(2):367-375. doi: 10.1134/S1068162023020097. Epub 2023 Feb 21.
Ref 218 Erratum to: Prospects for the Use of Marine Sulfated Fucose-Rich Polysaccharides in Treatment and Prevention of COVID-19 and Post-COVID-19 Syndrome. Russ J Bioorg Chem. 2022;48(6):1372. doi: 10.1134/S1068162022340015. Epub 2022 Dec 23.
Ref 219 Current Trends and Approaches to the Search for Genetic Determinants of Aging and Longevity. Russ J Genet. 2022;58(12):1427-1443. doi: 10.1134/S1022795422120067. Epub 2022 Dec 28.
Ref 220 Design, Synthesis, Anti-Tubercular Evaluation and Teratogenicity Studies of Furanyl Pyrazolo[3,4-b] Quinoline-5-Ones. Russ J Bioorg Chem. 2023;49(1):127-138. doi: 10.1134/S1068162023010053. Epub 2022 Dec 22.
Ref 221 Rapid Assessment of Neutralizing Antibodies Using Influenza Viruses with a Luciferase Reporter. Appl Biochem Microbiol. 2022;58(7):878-886. doi: 10.1134/S0003683822070067. Epub 2022 Dec 6.
Ref 222 Analysis of adiabatic trapping phenomena for quasi-integrable area-preserving maps in the presence of time-dependent exciters. Phys Rev E. 2022 Sep;106(3-1):034204. doi: 10.1103/PhysRevE.106.034204.
Ref 223 Synthesis, Antiviral, and Antibacterial Activity of the Glycyrrhizic Acid and Glycyrrhetinic Acid Derivatives. Russ J Bioorg Chem. 2022;48(5):906-918. doi: 10.1134/S1068162022050132. Epub 2022 Jul 28.
Ref 224 Erratum to: Evaluation of the Effects of Favipiravir Combined with Vitamin C on Alveolar Bone in Rats. J Evol Biochem Physiol. 2022;58(3):941. doi: 10.1134/S0022093022030280. Epub 2022 Jun 29.
Ref 225 Design, Synthesis, and Molecular Docking Studies of Some New Quinoxaline Derivatives as EGFR Targeting Agents. Russ J Bioorg Chem. 2022;48(3):565-575. doi: 10.1134/S1068162022030220. Epub 2022 Jun 21.
Ref 226 Identification of Some Promising Heterocycles Useful in Treatment of Allergic Rhinitis: Virtual Screening, Pharmacophore Mapping, Molecular Docking, and Molecular Dynamics. Russ J Bioorg Chem. 2022;48(2):438-456. doi: 10.1134/S1068162022330019. Epub 2022 May 26.
Ref 227 Erratum to: Experimental Search for New Means of Pathogenetic Therapy COVID-19: Inhibitor of H2-Receptors Famotidine Increases the Effect of Oseltamivir on Survival and Immune Status of Mice Infected by A/PR/8/34 (H1N1). J Evol Biochem Physiol. 2022;58(2):623. doi: 10.1134/S0022093022020284. Epub 2022 May 16.
Ref 228 MicroRNAs as the Potential Regulators of SARS-CoV-2 Infection and Modifiers of the COVID-19 Clinical Features. Mol Biol. 2022;56(1):29-45. doi: 10.1134/S0026893322010034. Epub 2022 Feb 12.
Ref 229 Predators as Control Agents of Mosquito Larvae in Micro-Reservoirs (Review). Inland Water Biol. 2022;15(1):39-53. doi: 10.1134/S1995082922010138. Epub 2022 Mar 12.
Ref 230 Molecular Beacon DNA Probes with Fluorescein Bifluorophore. Russ J Bioorg Chem. 2021;47(3):734-740. doi: 10.1134/S1068162021030055. Epub 2021 Jun 11.
Ref 231 Synthesis, Molecular Docking, In Silico ADME Predictions, and Toxicity Studies of N-Substituted-5-(4-Chloroquinolin-2-yl)-1,3,4-Thiadiazol-2-Amine Derivatives as COVID-19 Inhibitors. Russ J Bioorg Chem. 2021;47(1):158-165. doi: 10.1134/S1068162021010155. Epub 2021 Mar 20.
Ref 232 Mesomartoxin, a new K(v)1.2-selective scorpion toxin interacting with the channel selectivity filter. Biochem Pharmacol. 2015 Jan 15;93(2):232-9. doi: 10.1016/j.bcp.2014.12.002. Epub 2014 Dec 13.
Ref 233 Hemitoxin, the first potassium channel toxin from the venom of the Iranian scorpion Hemiscorpius lepturus. FEBS J. 2008 Sep;275(18):4641-50. doi: 10.1111/j.1742-4658.2008.06607.x. Epub 2008 Aug 11.
Ref 234 Cellular mechanisms and behavioral consequences of Kv1.2 regulation in the rat cerebellum. J Neurosci. 2012 Jul 4;32(27):9228-37. doi: 10.1523/JNEUROSCI.6504-11.2012.
Ref 235 Tuning Scorpion Toxin Selectivity: Switching From K(V)1.1 to K(V)1.3. Front Pharmacol. 2020 Jul 7;11:1010. doi: 10.3389/fphar.2020.01010. eCollection 2020.
Ref 236 Kalicludines and kaliseptine. Two different classes of sea anemone toxins for voltage sensitive K+ channels. J Biol Chem. 1995 Oct 20;270(42):25121-6. doi: 10.1074/jbc.270.42.25121.
Ref 237 PHAB toxins: a unique family of predatory sea anemone toxins evolving via intra-gene concerted evolution defines a new peptide fold. Cell Mol Life Sci. 2018 Dec;75(24):4511-4524. doi: 10.1007/s00018-018-2897-6. Epub 2018 Aug 14.
Ref 238 AbeTx1 Is a Novel Sea Anemone Toxin with a Dual Mechanism of Action on Shaker-Type K? Channels Activation. Mar Drugs. 2018 Oct 1;16(10):360. doi: 10.3390/md16100360.
Ref 239 BcsTx3 is a founder of a novel sea anemone toxin family of potassium channel blocker. FEBS J. 2013 Oct;280(19):4839-52. doi: 10.1111/febs.12456. Epub 2013 Aug 23.
Ref 240 The first potassium channel toxin from the venom of the Iranian scorpion Odonthobuthus doriae. FEBS Lett. 2006 Nov 13;580(26):6254-8. doi: 10.1016/j.febslet.2006.10.029. Epub 2006 Oct 20.
Ref 241 Purification and characterization of Ts15, the first member of a new -KTX subfamily from the venom of the Brazilian scorpion Tityus serrulatus. Toxicon. 2011 Jul;58(1):54-61. doi: 10.1016/j.toxicon.2011.05.001. Epub 2011 May 13.
Ref 242 Moving pieces in a venomic puzzle: unveiling post-translationally modified toxins from Tityus serrulatus. J Proteome Res. 2013 Jul 5;12(7):3460-70. doi: 10.1021/pr4003068. Epub 2013 Jun 13.
Ref 243 C-Terminal residues in small potassium channel blockers OdK1 and OSK3 from scorpion venom fine-tune the selectivity. Biochim Biophys Acta Proteins Proteom. 2017 May;1865(5):465-472. doi: 10.1016/j.bbapap.2017.02.001. Epub 2017 Feb 4.
Ref 244 Nucleotide sequence of crotamine isoform precursors from a single South American rattlesnake (Crotalus durissus terrificus). Toxicon. 1999 Jul;37(7):973-84. doi: 10.1016/s0041-0101(98)00226-8.
Ref 245 Structure and chromosomal localization of the gene for crotamine, a toxin from the South American rattlesnake, Crotalus durissus terrificus. Toxicon. 2003 Dec;42(7):747-52. doi: 10.1016/j.toxicon.2003.10.019.
Ref 246 Crotamine pharmacology revisited: novel insights based on the inhibition of KV channels. Mol Pharmacol. 2012 Jul;82(1):90-6. doi: 10.1124/mol.112.078188. Epub 2012 Apr 12.
Ref 247 Effect of crotamine, a toxin of South American rattlesnake venom, on the sodium channel of murine skeletal muscle. Br J Pharmacol. 1978 Jul;63(3):551-9. doi: 10.1111/j.1476-5381.1978.tb07811.x.
Ref 248 The analgesic activity of crotamine, a neurotoxin from Crotalus durissus terrificus (South American rattlesnake) venom: a biochemical and pharmacological study. Toxicon. 1998 Dec;36(12):1927-37. doi: 10.1016/s0041-0101(98)00117-2.
Ref 249 Crotamine is a novel cell-penetrating protein from the venom of rattlesnake Crotalus durissus terrificus. FASEB J. 2004 Sep;18(12):1407-9. doi: 10.1096/fj.03-1459fje. Epub 2004 Jul 1.
Ref 250 Crotamine mediates gene delivery into cells through the binding to heparan sulfate proteoglycans. J Biol Chem. 2007 Jul 20;282(29):21349-60. doi: 10.1074/jbc.M604876200. Epub 2007 May 9.
Ref 251 Crotamine inhibits preferentially fast-twitching muscles but is inactive on sodium channels. Toxicon. 2007 Sep 15;50(4):553-62. doi: 10.1016/j.toxicon.2007.04.026. Epub 2007 May 18.
Ref 252 Cytotoxic effects of crotamine are mediated through lysosomal membrane permeabilization. Toxicon. 2008 Sep 1;52(3):508-17. doi: 10.1016/j.toxicon.2008.06.029. Epub 2008 Jul 10.
Ref 253 Selective reciprocity in antimicrobial activity versus cytotoxicity of hBD-2 and crotamine. Proc Natl Acad Sci U S A. 2009 Sep 1;106(35):14972-7. doi: 10.1073/pnas.0904465106. Epub 2009 Aug 13.
Ref 254 Crotamine toxicity and efficacy in mouse models of melanoma. Expert Opin Investig Drugs. 2011 Sep;20(9):1189-200. doi: 10.1517/13543784.2011.602064.
Ref 255 In vitro antibacterial and hemolytic activities of crotamine, a small basic myotoxin from rattlesnake Crotalus durissus. J Antibiot (Tokyo). 2011 Apr;64(4):327-31. doi: 10.1038/ja.2011.10. Epub 2011 Mar 9.
Ref 256 The natural cell-penetrating peptide crotamine targets tumor tissue in vivo and triggers a lethal calcium-dependent pathway in cultured cells. Mol Pharm. 2012 Feb 6;9(2):211-21. doi: 10.1021/mp2000605. Epub 2011 Dec 23.
Ref 257 Unraveling the antifungal activity of a South American rattlesnake toxin crotamine. Biochimie. 2013 Feb;95(2):231-40. doi: 10.1016/j.biochi.2012.09.019. Epub 2012 Sep 26.
Ref 258 Biological versatility of crotamine--a cationic peptide from the venom of a South American rattlesnake. Expert Opin Investig Drugs. 2010 Dec;19(12):1515-25. doi: 10.1517/13543784.2010.534457. Epub 2010 Nov 10.
Ref 259 Solution structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom. Eur J Biochem. 2003 May;270(9):1969-79. doi: 10.1046/j.1432-1033.2003.03563.x.
Ref 260 Automated NMR structure determination and disulfide bond identification of the myotoxin crotamine from Crotalus durissus terrificus. Toxicon. 2005 Dec 1;46(7):759-67. doi: 10.1016/j.toxicon.2005.07.018. Epub 2005 Sep 26.
Ref 261 Genomic organization of three neurotoxins active on small conductance Ca2+-activated potassium channels from the scorpion Buthus martensi Karsch. FEBS Lett. 1999 Jun 11;452(3):360-4. doi: 10.1016/s0014-5793(99)00651-1.
Ref 262 Molecular cloning and sequencing of two 'short chain' and two 'long chain' K(+) channel-blocking peptides from the Chinese scorpion Buthus martensii Karsch. FEBS Lett. 1999 Sep 3;457(3):509-14. doi: 10.1016/s0014-5793(99)01101-1.
Ref 263 Characterization of four toxins from Buthus martensi scorpion venom, which act on apamin-sensitive Ca2+-activated K+ channels. Eur J Biochem. 1997 Apr 15;245(2):457-64. doi: 10.1111/j.1432-1033.1997.00457.x.
Ref 264 The antifungal plant defensin AtPDF2.3 from Arabidopsis thaliana blocks potassium channels. Sci Rep. 2016 Aug 30;6:32121. doi: 10.1038/srep32121.
Ref 265 Sunanda, Punnepalli, et al. "Identification, chemical synthesis, structure, and function of a new KV1 channel blocking peptide from Oulactis sp." Peptide Science 110.4 (2018): e24073.
Ref 266 Solution structure of BmP02, a new potassium channel blocker from the venom of the Chinese scorpion Buthus martensi Karsch. Biochemistry. 2000 Nov 14;39(45):13669-75. doi: 10.1021/bi000860s.
Ref 267 First report on BaltCRP, a cysteine-rich secretory protein (CRISP) from Bothrops alternatus venom: Effects on potassium channels and inflammatory processes. Int J Biol Macromol. 2019 Nov 1;140:556-567. doi: 10.1016/j.ijbiomac.2019.08.108. Epub 2019 Aug 14.
Ref 268 Protein surface topography as a tool to enhance the selective activity of a potassium channel blocker. J Biol Chem. 2019 Nov 29;294(48):18349-18359. doi: 10.1074/jbc.RA119.010494. Epub 2019 Sep 18.
Ref 269 Experimental conversion of a defensin into a neurotoxin: implications for origin of toxic function. Mol Biol Evol. 2014 Mar;31(3):546-59. doi: 10.1093/molbev/msu038. Epub 2014 Jan 14.
Ref 270 Structural similarity between defense peptide from wheat and scorpion neurotoxin permits rational functional design. J Biol Chem. 2014 May 16;289(20):14331-40. doi: 10.1074/jbc.M113.530477. Epub 2014 Mar 26.
Ref 271 Potassium channel blocker crafted by -hairpinin scaffold engineering. Biophys J. 2021 Jun 15;120(12):2471-2481. doi: 10.1016/j.bpj.2021.04.020. Epub 2021 Apr 29.
Ref 272 Artificial pore blocker acts specifically on voltage-gated potassium channel isoform K(V)1.6. J Biol Chem. 2022 Nov;298(11):102467. doi: 10.1016/j.jbc.2022.102467. Epub 2022 Sep 8.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.