Target Information
General Information of This Target
| Target ID |
BTDT00212
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Potassium voltage-gated channel subfamily A member 1 (Kcna1);Potassium voltage-gated channel subfamily A member 2 (Kcna2)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
Kcna1;Kcna2
|
|||||
| Gene ID | ||||||
| Synonym 1 |
RBKI; RCK1; Voltage-gated potassium channel subunit Kv1.1
|
|||||
| Synonym 2 |
RAK; RBK2; RCK5; Voltage-gated potassium channel subunit Kv1.2
|
|||||
| Sequence 1 |
MTVMSGENADEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS IVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRF FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE GEEQAQLLHVSSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTA TDQNCVNKSKLLTDV Click to Show/Hide
|
|||||
| Sequence 2 |
MTVATGDPVDEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF CLETLPIFRDENEDMHGGGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERDSQFPS IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA NCTLANTNYVNITKMLTDV Click to Show/Hide
|
|||||
| Family1 |
the potassium channel family
|
|||||
| Family2 |
the potassium channel family
|
|||||
| Function 1 |
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney. Contributes to the regulation of the membrane potential and nerve signaling, and prevents neuronal hyperexcitability. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA1 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heterotetrameric channel formed by KCNA1 and KCNA4 shows rapid inactivation. Regulates neuronal excitability in hippocampus, especially in mossy fibers and medial perforant path axons, preventing neuronal hyperexcitability. Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA) release. Plays a role in regulating the generation of action potentials and preventing hyperexcitability in myelinated axons of the vagus nerve, and thereby contributes to the regulation of heart contraction. Required for normal neuromuscular responses. Regulates the frequency of neuronal action potential firing in response to mechanical stimuli, and plays a role in the perception of pain caused by mechanical stimuli, but does not play a role in the perception of pain due to heat stimuli. Required for normal responses to auditory stimuli and precise location of sound sources, but not for sound perception. The use of toxins that block specific channels suggest that it contributes to the regulation of the axonal release of the neurotransmitter dopamine. Required for normal postnatal brain development and normal proliferation of neuronal precursor cells in the brain. Plays a role in the reabsorption of Mg(2+) in the distal convoluted tubules in the kidney and in magnesium ion homeostasis, probably via its effect on the membrane potential.
Click to Show/Hide
|
|||||
| Function 2 |
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the cardiovascular system. Prevents aberrant action potential firing and regulates neuronal output. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to a particular potassium channel family member. Homotetrameric KCNA2 forms a delayed- rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heteromultimer formed by KCNA2 and KCNA4 shows rapid inactivation. Response to toxins that are selective for KCNA1, respectively for KCNA2, suggests that heteromeric potassium channels composed of both KCNA1 and KCNA2 play a role in pacemaking and regulate the output of deep cerebellar nuclear neurons. KCNA2- containing channels play a presynaptic role and prevent hyperexcitability and aberrant action potential firing. Response to toxins that are selective for KCNA2- containing potassium channels suggests that in Purkinje cells, dendritic subthreshold KCNA2-containing potassium channels prevent random spontaneous calcium spikes, suppressing dendritic hyperexcitability without hindering the generation of somatic action potentials, and thereby play an important role in motor coordination. Plays a role in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus. May function as down-stream effector for G protein- coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA). Contributes to the regulation of the axonal release of the neurotransmitter dopamine. Reduced KCNA2 expression plays a role in the perception of neuropathic pain after peripheral nerve injury, but not acute pain. Plays a role in the regulation of the time spent in non-rapid eye movement (NREM) sleep. {, }.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| TCDB ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Potassium channel toxin Bgk (K25[Dab]) | . | . | [1] |
| Toxin Info Potassium channel toxin Bgk (K25[Dap]) | . | . | [1] |
| Toxin Info Potassium channel toxin Bgk (K25[Nle]) | . | . | [1] |
| Toxin Info Potassium channel toxin Bgk (K25[Orn]) | Dissociation constant |
0.38 nM
|
[1] |
| Toxin Info Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | Dissociation constant |
0.74 nM
|
[2], [3], [4], [5] |
| Toxin Info Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | Dissociation constant |
1.7 nM
|
[2], [3], [4], [5] |
| Toxin Info Toxin II.10.4 (7TP,D9Q) | Dissociation constant |
1.9 nM
|
[6] |
| Toxin Info Potassium channel toxin alpha-KTx 2.1 | Dissociation constant |
2 nM
|
[7], [8], [9] |
| Toxin Info Potassium channel toxin alpha-KTx 2.1 | Dissociation constant |
2 nM
|
[7], [8], [9], [10] |
| Toxin Info Potassium channel toxin alpha-KTx 3.2 | Dissociation constant |
3.4 nM
|
[11- 15] |
| Toxin Info Potassium channel toxin alpha-KTx 1.1 | Dissociation constant |
9 nM
|
[11- 31] |
| Toxin Info Potassium channel toxin alpha-KTx 1.1 | Dissociation constant |
10 nM
|
[11- 31] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | Dissociation constant |
20 nM
|
[13- 34] |
| Toxin Info Potassium channel toxin alpha-KTx 10.1 | Dissociation constant |
27 nM
|
[6- 35] |
| Toxin Info Potassium channel toxin ShK ([pTyr],[AEEA]) | Dissociation constant |
48 nM
|
[36] |
| Toxin Info Potassium channel toxin alpha-KTx 13.2 | Dissociation constant |
97 nM
|
[37] |
| Toxin Info PBTx1 | Dissociation constant |
100 nM
|
[38] |
| Toxin Info ChTX (K32[Cpa]) | Dissociation constant |
363 nM
|
[39] |
| Toxin Info ChTX (K32D) | Dissociation constant |
498 nM
|
[39] |
| Toxin Info Potassium channel toxin alpha-KTx 1.10 | Dissociation constant |
547 nM
|
[43], [44], [45] |
| Toxin Info ChTX (K32E) | Dissociation constant |
703 nM
|
[39] |
| Toxin Info Potassium channel toxin alpha-KTx 11.1 | Dissociation constant |
1 μM
|
[38- 47] |
| Toxin Info Potassium channel toxin Bgk (K25A,Y26A) | Dissociation constant |
30 μM
|
[1] |
| Toxin Info Potassium channel toxin kappa-KTx 1.2 | Dissociation constant |
150 μM
|
[48- 52] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | Inhibition constant |
0.5 nM
|
[45- 57] |
| Toxin Info Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | Inhibition constant |
0.6 nM
|
[2], [3], [4], [5] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | Inhibition constant |
1.1 nM
|
[45- 57] |
| Toxin Info Kunitz-type serine protease inhibitor homolog dendrotoxin K | Inhibition constant |
2 nM
|
[58- 64] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | Inhibition constant |
2.3 nM
|
[13- 34] |
| Toxin Info Potassium channel toxin alpha-KTx 3.4 | Inhibition constant |
3.5 nM
|
[11- 65] |
| Toxin Info Potassium channel toxin alpha-KTx 3.4 | Inhibition constant |
4.5 nM
|
[11- 65] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | Inhibition constant |
6.3 nM
|
[13- 34] |
| Toxin Info N.vectensis toxin 4 | Effect | . | [66] |
| Toxin Info N.vectensis toxin 5 | Effect | . | [66] |
| Toxin Info Mu-conotoxin CnIIIC | Inhibition rate | . | [67], [68], [69] |
| Toxin Info Jingzhaotoxin F7-15.33 | Inhibition rate | . | [70] |
| Toxin Info Kunitz-type serine protease inhibitor homolog dendrotoxin K | Inhibition rate | . | [60] |
| Toxin Info Mu-conotoxin GIIIA | Inhibition rate | . | [71- 83] |
| Toxin Info Toxin PhcrTx2 | Inhibition rate | . | [84] |
| Toxin Info Apamin | Inhibition rate | . | [40- 101] |
| Toxin Info Potassium channel toxin alpha-KTx 3.11 | Inhibition rate | . | [102] |
| Toxin Info Mu-theraphotoxin-Pspp1 | Inhibition rate | . | [103] |
| Toxin Info Mu-conotoxin PIIIA | Inhibition rate | . | [67- 107] |
| Toxin Info Mu-conotoxin SIIIA | Inhibition rate | . | [67- 132] |
| Toxin Info Potassium channel toxin alpha-KTx 15.2 | Inhibition rate | . | [133] |
| Toxin Info Potassium channel toxin alpha-KTx 19.1 | Inhibition rate | . | [134] |
| Toxin Info Potassium channel toxin alpha-KTx 6.3 | Inhibition rate | . | [135] |
| Toxin Info Potassium channel toxin alpha-KTx 8.2 | Inhibition rate | . | [136] |
| Toxin Info Potassium channel toxin kappa-KTx 1.3 | Inhibition rate | . | [51] |
| Toxin Info Kappa-hefutoxin 2 | Inhibition rate | . | [49] |
| Toxin Info Kappa-HfTx2 (C1A,T2C,A3Y,S4R,K5N,Q6C,C7W,W8R,P9E,V10G,C11N,N12D,Q13E,M14E,F15T,G16C,P18E,N19R,G20C) | Inhibition rate | . | [49] |
| Toxin Info Potassium channel toxin alpha-KTx 8.6 | Inhibition rate | . | [136], [137] |
| Toxin Info Potassium channel toxin alpha-KTx 8.6 | Inhibition rate | . | [136] |
| Toxin Info Potassium channel toxin kappa-KTx 2.5 | Inhibition rate | . | [138] |
| Toxin Info Potassium channel toxin TsTXK-beta | Inhibition rate | . | [139] |
| Toxin Info Potassium channel toxin alpha-KTx 16.4 | Inhibition rate | . | [140] |
| Toxin Info Neurotoxin lambda-MeuTx | Inhibition rate | . | [141] |
| Toxin Info KappaPI-actitoxin-Ael3a | Inhibition rate | . | [142], [143] |
| Toxin Info Peptide 401 (I1H,,fLys,2A,N4Y,C5R,K6N,R7C,H8W,V9R,I10E,K11G,P12N,H13D,I14E,C15E,R16T,,fLys,17C,I18K,C19E,G20R,,fLys,21C) | Inhibition rate | . | [49] |
| Toxin Info Potassium channel toxin Bgk (K25A) | Inhibition rate |
2 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (F6A) | Inhibition rate |
3 %
|
[1] |
| Toxin Info Peptide TsPep3 | Inhibition rate |
5 %
|
[53- 145] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.2 | Inhibition rate |
5 %
|
[53- 146] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.2 | Inhibition rate |
5 %
|
[146] |
| Toxin Info Potassium channel toxin MeuTXKalpha3 | Inhibition rate |
6 %
|
[147] |
| Toxin Info Potassium channel toxin kappa-KTx 2.3 | Inhibition rate |
8 %
|
[148] |
| Toxin Info Potassium channel toxin Bgk (Y26A) | Inhibition rate |
9 %
|
[1] |
| Toxin Info Potassium channel toxin kappa-KTx 2.2 | Inhibition rate |
10 %
|
[148] |
| Toxin Info Potassium channel toxin Bgk (R12A) | Inhibition rate |
14 %
|
[1] |
| Toxin Info Potassium channel toxin kappa-KTx 2.2 | Inhibition rate |
14 %
|
[148] |
| Toxin Info Potassium channel toxin Bgk (H13A) | Inhibition rate |
17 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (S23A) | Inhibition rate |
17 %
|
[1] |
| Toxin Info Potassium channel toxin alpha-KTx 3.2 (K19S) | Inhibition rate |
19 %
|
[149] |
| Toxin Info Pi-stichotoxin-Hcr5b | Inhibition rate |
20 %
|
[150] |
| Toxin Info Calcium channel toxin-like peptide-1 | Inhibition rate |
25 %
|
[141] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.1 | Inhibition rate |
25 %
|
[146] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.1 | Inhibition rate |
25 %
|
[53- 151] |
| Toxin Info Potassium channel toxin Bgk (R27A) | Inhibition rate |
26 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (R3A) | Inhibition rate |
27 %
|
[1] |
| Toxin Info Potassium channel toxin alpha-KTx (N30P) | Inhibition rate |
29 %
|
[147] |
| Toxin Info Potassium channel toxin Bgk (N29A) | Inhibition rate |
33 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (L36A) | Inhibition rate |
34 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (R21A) | Inhibition rate |
34 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (N19A) | Inhibition rate |
40 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (W5A) | Inhibition rate |
45 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (T33A) | Inhibition rate |
46 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (K15A) | Inhibition rate |
52 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (K7A) | Inhibition rate |
52 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (K32A) | Inhibition rate |
55 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (L17A) | Inhibition rate |
62 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (Q24A) | Inhibition rate |
63 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (S16A) | Inhibition rate |
65 %
|
[1] |
| Toxin Info Kappa-conotoxin SrXIA | Inhibition rate |
66 %
|
[152], [153] |
| Toxin Info Kunitz-type conkunitzin-S1 | Inhibition rate |
70 %
|
[154], [155], [156] |
| Toxin Info Potassium channel toxin alpha-KTx 3.6 | Inhibition rate |
73 %
|
[157] |
| Toxin Info Potassium channel toxin Bgk (T22A) | Inhibition rate |
80 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (E35A) | Inhibition rate |
85 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (T9A) | Inhibition rate |
85 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (V1A) | Inhibition rate |
85 %
|
[1] |
| Toxin Info Potassium channel toxin Bgk (E8A) | Inhibition rate |
86 %
|
[1] |
| Toxin Info Potassium channel toxin alpha-KTx 19.2 | Inhibition rate |
100 %
|
[158] |
| Toxin Info Potassium channel toxin alpha-KTx 31.1 | Inhibition rate |
100 %
|
[159] |
| Toxin Info Potassium channel toxin alpha-KTx 3.2 | Inhibition rate |
100 %
|
[160] |
| Toxin Info Potassium channel toxin alpha-KTx 3.7 | Inhibition rate |
100 %
|
[160] |
| Toxin Info Potassium channel toxin alpha-KTx 31.1 | Inhibition rate |
100 %
|
[159] |
| Toxin Info Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | Effective concentration 50 |
0.38 nM
|
[161] |
| Toxin Info Potassium channel toxin alpha-KTx 20.1 | Effective concentration 50 |
102 nM
|
[162] |
| Toxin Info Potassium channel toxin alpha-KTx 6.4 | IC50 |
8 pM
|
[163], [164], [165] |
| Toxin Info Kappa-actitoxin-Bcs3a | IC50 |
0.03 nM
|
[166] |
| Toxin Info Kappa-actitoxin-Bcs3a | IC50 |
0.03 nM
|
[166] |
| Toxin Info Toxin MeKTx11-3 (S37P) | IC50 |
0.07 nM
|
[167] |
| Toxin Info MTX (K15Q,G34C) | IC50 |
0.074 nM
|
[168] |
| Toxin Info Toxin MeKTx11-3 (V9G) | IC50 |
0.09 nM
|
[167] |
| Toxin Info MTX (S1A) | IC50 |
0.13 nM
|
[169] |
| Toxin Info AgTx2 (R24A) | IC50 |
0.14 nM
|
[12] |
| Toxin Info MTX (G33A) | IC50 |
0.142 nM
|
[168] |
| Toxin Info Potassium channel toxin alpha-KTx 1.16 | IC50 |
0.19 nM
|
[137- 167] |
| Toxin Info Potassium channel toxin alpha-KTx 1.16 | IC50 |
0.19 nM
|
[167] |
| Toxin Info Potassium channel toxin alpha-KTx 6.1 | IC50 |
0.44 nM
|
[170- 177] |
| Toxin Info MTX (P12A,P20A,G34C) | IC50 |
0.68 nM
|
[178] |
| Toxin Info Potassium channel toxin alpha-KTx 6.2 | IC50 |
0.8 nM
|
[12- 184] |
| Toxin Info MTX (C19[Abu],C34[Abu]) | IC50 |
1.7 nM
|
[185] |
| Toxin Info Potassium channel toxin alpha-KTx 9.5 | IC50 |
2.5 nM
|
[186] |
| Toxin Info Pi1 (C20[Abu],[Abu]) | IC50 |
3 nM
|
[177] |
| Toxin Info Potassium channel toxin alpha-KTx 1.17 | IC50 |
3.1 nM
|
[167] |
| Toxin Info Potassium channel toxin alpha-KTx 1.17 | IC50 |
3.1 nM
|
[137- 167] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | IC50 |
4.4 nM
|
[13- 34] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | IC50 |
6 nM
|
[13- 34] |
| Toxin Info Potassium channel toxin alpha-KTx 12.2 | IC50 |
6.19 nM
|
[187], [188] |
| Toxin Info Potassium channel toxin alpha-KTx 12.1 | IC50 |
6.19 nM
|
[53- 194] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | IC50 |
6.4 nM
|
[13- 34] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | IC50 |
7 nM
|
[13- 34] |
| Toxin Info Potassium channel toxin alpha-KTx 3.13 | IC50 |
8.92 nM
|
[157] |
| Toxin Info Potassium channel toxin alpha-KTx 3.13 | IC50 |
8.92 nM
|
[157] |
| Toxin Info Potassium channel toxin alpha-KTx 3.4 | IC50 |
9 nM
|
[11- 65] |
| Toxin Info Kappa-stichotoxin-She3a | IC50 |
9 nM
|
[36- 208] |
| Toxin Info Kappa-stichotoxin-Hmg1a | IC50 |
10 nM
|
[143- 210] |
| Toxin Info Potassium channel toxin alpha-KTx 3.12 | IC50 |
10.4 nM
|
[211] |
| Toxin Info MeuKTx (G11R,G30R,D33H) | IC50 |
10.7 nM
|
[212- 231] |
| Toxin Info Potassium channel toxin alpha-KTx 3.1 | IC50 |
11 nM
|
[13- 34] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | IC50 |
11 nM
|
[45- 57] |
| Toxin Info Potassium channel toxin alpha-KTx 3.4 | IC50 |
12 nM
|
[11- 65] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | IC50 |
12 nM
|
[45- 57] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | IC50 |
14 nM
|
[45- 57] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | IC50 |
15 nM
|
[45- 57] |
| Toxin Info Mesomartoxin | IC50 |
15.6 nM
|
[232] |
| Toxin Info Mesomartoxin | IC50 |
15.6 nM
|
[232] |
| Toxin Info Potassium channel toxin alpha-KTx 6.15 | IC50 |
16 nM
|
[233] |
| Toxin Info Potassium channel toxin alpha-KTx 6.15 | IC50 |
16 nM
|
[233] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | IC50 |
17 nM
|
[45- 57] |
| Toxin Info Potassium channel toxin alpha-KTx 3.4 | IC50 |
20 nM
|
[11- 65] |
| Toxin Info Potassium channel toxin ShK (K22[Dap]) | IC50 |
39 nM
|
[203] |
| Toxin Info Pi1 (R5A,R12A) | IC50 |
67 nM
|
[175] |
| Toxin Info Pi1 (Y33[pTyr]) | IC50 |
75 nM
|
[175] |
| Toxin Info Kappa-actitoxin-Bcs3b | IC50 |
80.4 nM
|
[166] |
| Toxin Info Kappa-actitoxin-Bcs3b | IC50 |
80.4 nM
|
[166] |
| Toxin Info Tst26 (Q19E,A20C) | IC50 |
100 nM
|
[234] |
| Toxin Info Potassium channel toxin alpha-KTx 3.19 | IC50 |
106 nM
|
[235] |
| Toxin Info Kappa-actitoxin-Avd6a | IC50 |
140 nM
|
[143- 236] |
| Toxin Info Kappa-actitoxin-Ate1a | IC50 |
146 nM
|
[237] |
| Toxin Info Potassium channel toxin alpha-KTx 12.1 | IC50 |
165 nM
|
[53- 194] |
| Toxin Info Potassium channel toxin AbeTx1 | IC50 |
167 nM
|
[238] |
| Toxin Info Kappa-actitoxin-Bcs4a | IC50 |
172.59 nM
|
[239] |
| Toxin Info Kappa-actitoxin-Bcs4a | IC50 |
172.59 nM
|
[239] |
| Toxin Info Potassium channel toxin alpha-KTx 8.5 | IC50 |
183 nM
|
[240] |
| Toxin Info Potassium channel toxin alpha-KTx 21.1 | IC50 |
196 nM
|
[53- 242] |
| Toxin Info Potassium channel toxin alpha-KTx 21.1 | IC50 |
196 nM
|
[53- 242] |
| Toxin Info Toxin MeKTx13-3 (Q12A,K15A,K18A,D33R) | IC50 |
208 nM
|
[235] |
| Toxin Info Potassium channel toxin alpha-KTx 8.8 | IC50 |
331 nM
|
[243] |
| Toxin Info Potassium channel toxin alpha-KTx 8.8 | IC50 |
331 nM
|
[243] |
| Toxin Info Pi1 (K31A) | IC50 |
383 nM
|
[175] |
| Toxin Info Crotamine | IC50 |
386 nM
|
[244- 260] |
| Toxin Info Potassium channel toxin alpha-KTx 9.2 | IC50 |
530 nM
|
[261], [262], [263] |
| Toxin Info Plant defensin 2.3 (G36N) | IC50 |
611 nM
|
[264] |
| Toxin Info Pi1 (R5A,K31A) | IC50 |
623 nM
|
[175] |
| Toxin Info TstBut | IC50 |
919 nM
|
[169] |
| Toxin Info KappaPI-actitoxin-Avd3c | IC50 |
1.1 μM
|
[143- 236] |
| Toxin Info KappaPI-actitoxin-Avd3d | IC50 |
1.3 μM
|
[143- 236] |
| Toxin Info Defensin-like protein 1 | IC50 |
1.3 μM
|
[264] |
| Toxin Info Plant defensin 2.3 (K33A,G36N) | IC50 |
1.38 μM
|
[264] |
| Toxin Info U-actitoxin-Oulsp1 | IC50 |
1.778 μM
|
[265] |
| Toxin Info Plant defensin 2.3 (K33A) | IC50 |
2.039 μM
|
[264] |
| Toxin Info Potassium channel toxin alpha-KTx 3.18 | IC50 |
2.6777 μM
|
[212- 231] |
| Toxin Info KappaPI-actitoxin-Avd3b | IC50 |
2.8 μM
|
[143- 236] |
| Toxin Info Potassium channel toxin alpha-KTx 9.1 | IC50 |
4.4 μM
|
[47- 266] |
| Toxin Info Pi1 (K24A,Y33A) | IC50 |
22 μM
|
[175] |
| Toxin Info Kappa-hefutoxin 3 (E20K) | IC50 |
36.8 μM
|
[51] |
| Toxin Info Kappa-hefutoxin 3 (K20E) | IC50 |
36.9 μM
|
[51] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
