Target Information
General Information of This Target
| Target ID |
BTDT00058
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Potassium voltage-gated channel subfamily A member 2 (KCNA2)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
KCNA2
|
|||||
| Gene ID | ||||||
| Synonym |
NGK1; Voltage-gated K(+) channel HuKIV; Voltage-gated potassium channel HBK5; Voltage-gated potassium channel subunit Kv1.2
|
|||||
| Sequence |
MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF CLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPS IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA NCTLANTNYVNITKMLTDV Click to Show/Hide
|
|||||
| Family |
the potassium channel family
|
|||||
| Function |
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the cardiovascular system. Prevents aberrant action potential firing and regulates neuronal output. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA2 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heteromultimer formed by KCNA2 and KCNA4 shows rapid inactivation. Regulates neuronal excitability and plays a role as pacemaker in the regulation of neuronal action potentials. KCNA2- containing channels play a presynaptic role and prevent hyperexcitability and aberrant action potential firing. Response to toxins that are selective for KCNA2-containing potassium channels suggests that in Purkinje cells, dendritic subthreshold KCNA2- containing potassium channels prevent random spontaneous calcium spikes, suppressing dendritic hyperexcitability without hindering the generation of somatic action potentials, and thereby play an important role in motor coordination. Plays a role in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA). Contributes to the regulation of the axonal release of the neurotransmitter dopamine. Reduced KCNA2 expression plays a role in the perception of neuropathic pain after peripheral nerve injury, but not acute pain. Plays a role in the regulation of the time spent in non-rapid eye movement (NREM) sleep.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| TCDB ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Bgk (W5Y,F6A,Y26F) | . | . | [1] |
| Toxin Info Potassium channel toxin alpha-KTx 2.2 | Dissociation constant |
6 pM
|
[2] |
| Toxin Info Venom basic protease inhibitor 1 homolog (L3R,Q18D,G34R,T36D,R59G) | Dissociation constant |
0.012 nM
|
[1] |
| Toxin Info Bgk (W5Y,Y26F) | Dissociation constant |
0.077 nM
|
[1] |
| Toxin Info Potassium channel toxin alpha-KTx 23.1 | Dissociation constant |
0.54 nM
|
[3] |
| Toxin Info Potassium channel toxin alpha-KTx 32.1 | Dissociation constant |
0.96 nM
|
[4] |
| Toxin Info Potassium channel toxin alpha-KTx 4.6 | Dissociation constant |
1.9 nM
|
[5] |
| Toxin Info Potassium channel toxin alpha-KTx 6.12 | Dissociation constant |
6.14 nM
|
[6] |
| Toxin Info Kappa-actitoxin-Bgr1a | Dissociation constant |
15 nM
|
[7] |
| Toxin Info Anuroctoxin (N17A) | Dissociation constant |
20 nM
|
[8] |
| Toxin Info Potassium channel toxin ShK (C3[Abu],C39[Abu]) | Dissociation constant |
56 nM
|
[9] |
| Toxin Info Potassium channel toxin alpha-KTx 4.8 | Dissociation constant |
65 nM
|
[10] |
| Toxin Info Potassium channel toxin alpha-KTx 24.1 | Dissociation constant |
92 nM
|
[11] |
| Toxin Info Toxin VmKTx1 | Dissociation constant |
7.1 μM
|
[12] |
| Toxin Info Toxin VmKTx1 | Dissociation constant |
7.1 μM
|
[12], [13] |
| Toxin Info Anuroctoxin (N17A,F32T) | Dissociation constant |
9.6 μM
|
[8] |
| Toxin Info Kappa-actitoxin-Bgr1a | Inhibition constant |
0.066 nM
|
[1] |
| Toxin Info Bgk (W5Y,Y26F) | Inhibition constant |
0.369 nM
|
[1] |
| Toxin Info Kappa-stichotoxin-Hmg1a | Inhibition constant |
2.5 nM
|
[14] |
| Toxin Info Potassium channel toxin ShK (K22[Dap]) | Inhibition constant |
20.75 nM
|
[15] |
| Toxin Info Bgk (W5Y,F6A,Y26F) | Inhibition constant |
289.2 nM
|
[1] |
| Toxin Info Kappa-actitoxin-Aer3a | Inhibition constant |
2.243 μM
|
[14] |
| Toxin Info Toxin MeKTx13-3 (D19K) | Inhibition rate | . | [16] |
| Toxin Info Toxin MeKTx13-3 (G11R,I28T,D33H) | Inhibition rate | . | [17] |
| Toxin Info Toxin MeKTx13-3 (K6D,D19K) | Inhibition rate | . | [16] |
| Toxin Info Toxin MeKTx13-3 (K6T,K8N,H9E,G11R,L14Y,K15N,K18G,M22Y,R23P,I28T,N29Y,D33H,T35K,K37Q) | Inhibition rate | . | [18] |
| Toxin Info Anuroctoxin (F32T) | Inhibition rate | . | [8] |
| Toxin Info Kappa-conotoxin ViTx | Inhibition rate | . | [19], [20] |
| Toxin Info Scorpine-like peptide Ev37 | Inhibition rate | . | [21] |
| Toxin Info U-actitoxin-Avd3n | Inhibition rate | . | [22] |
| Toxin Info Defensin domain protein | Inhibition rate | . | [23] |
| Toxin Info U-actitoxin-Oulsp2 | Inhibition rate | . | [24] |
| Toxin Info Beta/omega-theraphotoxin-Tp2a | Inhibition rate | . | [25- 44] |
| Toxin Info Kunitz-type serine protease inhibitor homolog dendrotoxin K | Inhibition rate | . | [45] |
| Toxin Info Potassium channel gamma toxin gamma-KTx 1.9 | Inhibition rate | . | [46] |
| Toxin Info Contryphan-Vn | Inhibition rate | . | [47], [48], [49] |
| Toxin Info Beta-defensin 104 | Inhibition rate | . | [50] |
| Toxin Info OsK1 (E16K,K20D) | Inhibition rate | . | [51] |
| Toxin Info Kappa-theraphotoxin-Pg1a | Inhibition rate | . | [52], [53], [54], [55] |
| Toxin Info Kunitz-type serine protease inhibitor Hg1 | Inhibition rate |
<50 %
|
[56], [57] |
| Toxin Info BmK86-P9 | Inhibition rate |
1.8 %
|
[58] |
| Toxin Info Neurotoxin BmK86 (K19A) | Inhibition rate |
2 %
|
[58] |
| Toxin Info Kcug1 (C1K,T2C,A3T,S4A,K5S,Q6K,C7Q,W8C,P9W,V10P,C11V,N12C,Q13N,M14Q,F15M,G16F,K17G,P18K,N19P,G20N,K21G,C22K,M23C,N24M,G25N,K26G,C27K,R28C,C29R) | Inhibition rate |
2 %
|
[59] |
| Toxin Info Kcug1 (K27A) | Inhibition rate |
2.4 %
|
[59] |
| Toxin Info Kcug1 (C1T,T2D,A3V,S4K,K5C,Q6T,C7A,W8S,P9K,V10Q,N12W,Q13P,M14V,F15C,G16N,K17Q,P18M,N19F,C22P,M23N,N24G,G25K,K26C,C27M,R28N,C29G) | Inhibition rate |
2.4 %
|
[59] |
| Toxin Info Conotoxin PlXIVA | Inhibition rate |
2.5 %
|
[58] |
| Toxin Info Neurotoxin BmK86 (I21A) | Inhibition rate |
3 %
|
[58] |
| Toxin Info Kappa-HfTx2 | Inhibition rate |
3.2 %
|
[59] |
| Toxin Info Fungal defensin plectasin | Inhibition rate |
4 %
|
[60] |
| Toxin Info Beta/omega-theraphotoxin-Tp1a | Inhibition rate |
6 %
|
[25- 64] |
| Toxin Info Potassium channel toxin Sp4 | Inhibition rate |
7 %
|
[65] |
| Toxin Info Neutrophil defensin 1 | Inhibition rate |
7 %
|
[66] |
| Toxin Info Defensin alpha 5 | Inhibition rate |
7 %
|
[66] |
| Toxin Info Beta-defensin 3 | Inhibition rate |
9 %
|
[67] |
| Toxin Info Potassium channel toxin alpha-KTx 23.2 | Inhibition rate |
9.8 %
|
[68] |
| Toxin Info Defensin BmKDfsin5 | Inhibition rate |
10 %
|
[69] |
| Toxin Info Kunitz-type serine protease inhibitor HCRG21 | Inhibition rate |
11 %
|
[70] |
| Toxin Info Beta-defensin 1 | Inhibition rate |
13 %
|
[71] |
| Toxin Info Defensin beta 4A | Inhibition rate |
16 %
|
[72] |
| Toxin Info Neurotoxin BmK86 (N17A) | Inhibition rate |
25 %
|
[58] |
| Toxin Info Kcug1 (Y36A) | Inhibition rate |
26.3 %
|
[59] |
| Toxin Info Defensin BmKDfsin3 | Inhibition rate |
28 %
|
[69- 73] |
| Toxin Info Neurotoxin BmK86 (R24A) | Inhibition rate |
30 %
|
[58] |
| Toxin Info Potassium channel toxin kappa-KTx 2.9 | Inhibition rate |
31 %
|
[11] |
| Toxin Info Defensin BmKDfsin4 | Inhibition rate |
31 %
|
[74] |
| Toxin Info Defensin domain protein | Inhibition rate |
33 %
|
[23] |
| Toxin Info Potassium channel toxin KTx1 | Inhibition rate |
42 %
|
[75] |
| Toxin Info Potassium channel toxin KTx1 | Inhibition rate |
42 %
|
[75] |
| Toxin Info Beta-defensin 103 | Inhibition rate |
51 %
|
[50] |
| Toxin Info Kcug1 (M29A) | Inhibition rate |
64.9 %
|
[59] |
| Toxin Info Kcug1 (N30A) | Inhibition rate |
71.8 %
|
[59] |
| Toxin Info Kappa-buthitoxin-Tt2b | Inhibition rate |
75 %
|
[76] |
| Toxin Info Kcug1 (N25A) | Inhibition rate |
78.7 %
|
[59] |
| Toxin Info Kcug1 (R34A) | Inhibition rate |
78.7 %
|
[59] |
| Toxin Info Kcug1 (K32A) | Inhibition rate |
82.5 %
|
[59] |
| Toxin Info Kcug1 (S10A) | Inhibition rate |
84.1 %
|
[59] |
| Toxin Info Kcug1 (Q12A) | Inhibition rate |
87.2 %
|
[59] |
| Toxin Info Kcug1 (K11A) | Inhibition rate |
88.1 %
|
[59] |
| Toxin Info ChTx-b | IC50 |
6 pM
|
[77] |
| Toxin Info Potassium channel toxin alpha-KTx 6.21 | IC50 |
0.11 - 0.16 nM
|
[78], [79] |
| Toxin Info Potassium channel toxin alpha-KTx 6.21 | IC50 |
0.16 nM
|
[78] |
| Toxin Info Uro (T19Q) | IC50 |
0.244 nM
|
[79] |
| Toxin Info Potassium channel toxin alpha-KTx 2.15 | IC50 |
0.3 nM
|
[46] |
| Toxin Info Potassium channel toxin alpha-KTx 2.15 | IC50 |
0.3 nM
|
[46] |
| Toxin Info Potassium channel toxin alpha-KTx 2.16 | IC50 |
0.7 nM
|
[46] |
| Toxin Info Potassium channel toxin alpha-KTx 2.16 | IC50 |
0.7 nM
|
[46] |
| Toxin Info Neurotoxin HsTX1 (R14A) | IC50 |
0.863 nM
|
[80] |
| Toxin Info Potassium channel toxin alpha-KTx 2.13 | IC50 |
1.3 nM
|
[81] |
| Toxin Info Potassium channel toxin alpha-KTx 2.17 | IC50 |
2.9 nM
|
[46] |
| Toxin Info Potassium channel toxin alpha-KTx 2.17 | IC50 |
2.9 nM
|
[46] |
| Toxin Info OsK1 (E16K,K20D) | IC50 |
2.96 nM
|
[82] |
| Toxin Info Potassium channel toxin alpha-KTx 10.4 | IC50 |
3.6 nM
|
[46] |
| Toxin Info Potassium channel toxin alpha-KTx 10.4 | IC50 |
3.6 nM
|
[46] |
| Toxin Info OsK1 (E16K) | IC50 |
5.23 nM
|
[82] |
| Toxin Info Potassium channel toxin alpha-KTx 3.7 | IC50 |
5.4 nM
|
[82] |
| Toxin Info Potassium channel toxin alpha-KTx J123 | IC50 |
26.4 nM
|
[83] |
| Toxin Info BmK86-P1 | IC50 |
28.5 nM
|
[58] |
| Toxin Info OsK1 (E15K,K19D) | IC50 |
30 nM
|
[51] |
| Toxin Info Kappa-conotoxin RIIIJ | IC50 |
33 nM
|
[84] |
| Toxin Info Potassium channel toxin alpha-KTx 1.15 | IC50 |
46 nM
|
[59] |
| Toxin Info Kappa-M-RIIIJ (K10R,H11L) | IC50 |
48 nM
|
[84] |
| Toxin Info Kappa-M-RIIIJ (T6S,P7L,P8N) | IC50 |
67 nM
|
[84] |
| Toxin Info OsK1 (K20D) | IC50 |
77.8 nM
|
[82] |
| Toxin Info Kcug1 (C1V,T2K,A3C,S4T,K5A,Q6S,C7K,W8Q,P9C,V10W,C11P,N12V,Q13C,M14N,F15Q,G16M,K17F,P18G,N19K,G20P,K21N,C22G,M23K,N24C,G25M,K26N,C27G,R28K) | IC50 |
89.9 nM
|
[59] |
| Toxin Info Kappa-conotoxin RIIIJ | IC50 |
98.3 nM
|
[85] |
| Toxin Info OsK1 (V1T,E15K,K19D) | IC50 |
100 nM
|
[51] |
| Toxin Info Conotoxin R3.1 (L9K) | IC50 |
102 nM
|
[84] |
| Toxin Info MTX (K23A) | IC50 |
170 nM
|
[86] |
| Toxin Info PI-stichotoxin-Hcr2g | IC50 |
181.7 nM
|
[70] |
| Toxin Info PI-stichotoxin-Hcr2g | IC50 |
181.7 nM
|
[70- 88] |
| Toxin Info MTX (Y32A) | IC50 |
190 nM
|
[86] |
| Toxin Info OsK1 (E16K,K20D) | IC50 |
196 nM
|
[82] |
| Toxin Info OsK1 (E16K,K20D,T36Y) | IC50 |
232 nM
|
[82] |
| Toxin Info Kappa-M-RIIIJ (K9L,K10R,H11L) | IC50 |
336 nM
|
[84] |
| Toxin Info Kappa-conotoxin RIIIK | IC50 |
352 nM
|
[84] |
| Toxin Info Kappa-M-RIIIJ (T6S,P7L,P8N,K9L,K10R,H11L) | IC50 |
374 nM
|
[84] |
| Toxin Info ([20kDa-PEG] -(Lys16)-ShK | IC50 |
639 nM
|
[89] |
| Toxin Info Kunitz-type serine protease inhibitor Hg1 | IC50 |
1 μM
|
[57] |
| Toxin Info Kunitz-type conkunitzin-S1 | IC50 |
3.4 μM
|
[90], [91], [92] |
| Toxin Info Kunitz-type conkunitzin-S1 | IC50 |
4.18 μM
|
[90], [91], [92] |
| Toxin Info Uro | IC50 |
8 μM
|
[79] |
| Toxin Info Uro (K25A) | IC50 |
13.1 μM
|
[79] |
| Toxin Info PI-stichotoxin-Hcr2f | IC50 |
52 μM
|
[70- 88] |
| Toxin Info PI-stichotoxin-Hcr2f | IC50 |
52.199 μM
|
[70] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
