General Information of This Target
Target ID
BTDT00058
Target Name
Potassium voltage-gated channel subfamily A member 2 (KCNA2)
Target Bioclass
Transporter and channel
Uniprot ID
P16389
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
KCNA2
Gene ID
3737
Synonym
NGK1; Voltage-gated K(+) channel HuKIV; Voltage-gated potassium channel HBK5; Voltage-gated potassium channel subunit Kv1.2
Sequence
MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPS
IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA
NCTLANTNYVNITKMLTDV

    Click to Show/Hide
Family
the potassium channel family
Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the cardiovascular system. Prevents aberrant action potential firing and regulates neuronal output. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA2 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heteromultimer formed by KCNA2 and KCNA4 shows rapid inactivation. Regulates neuronal excitability and plays a role as pacemaker in the regulation of neuronal action potentials. KCNA2- containing channels play a presynaptic role and prevent hyperexcitability and aberrant action potential firing. Response to toxins that are selective for KCNA2-containing potassium channels suggests that in Purkinje cells, dendritic subthreshold KCNA2- containing potassium channels prevent random spontaneous calcium spikes, suppressing dendritic hyperexcitability without hindering the generation of somatic action potentials, and thereby play an important role in motor coordination. Plays a role in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA). Contributes to the regulation of the axonal release of the neurotransmitter dopamine. Reduced KCNA2 expression plays a role in the perception of neuropathic pain after peripheral nerve injury, but not acute pain. Plays a role in the regulation of the time spent in non-rapid eye movement (NREM) sleep.

    Click to Show/Hide
Taxonomy ID
9606
TCDB ID
1.A.1.2.10
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Bgk (W5Y,F6A,Y26F) . . [1]
 Toxin Info    Potassium channel toxin alpha-KTx 2.2 Dissociation constant
6 pM
[2]
 Toxin Info    Venom basic protease inhibitor 1 homolog (L3R,Q18D,G34R,T36D,R59G) Dissociation constant
0.012 nM
[1]
 Toxin Info    Bgk (W5Y,Y26F) Dissociation constant
0.077 nM
[1]
 Toxin Info    Potassium channel toxin alpha-KTx 23.1 Dissociation constant
0.54 nM
[3]
 Toxin Info    Potassium channel toxin alpha-KTx 32.1 Dissociation constant
0.96 nM
[4]
 Toxin Info    Potassium channel toxin alpha-KTx 4.6 Dissociation constant
1.9 nM
[5]
 Toxin Info    Potassium channel toxin alpha-KTx 6.12 Dissociation constant
6.14 nM
[6]
 Toxin Info    Kappa-actitoxin-Bgr1a Dissociation constant
15 nM
[7]
 Toxin Info    Anuroctoxin (N17A) Dissociation constant
20 nM
[8]
 Toxin Info    Potassium channel toxin ShK (C3[Abu],C39[Abu]) Dissociation constant
56 nM
[9]
 Toxin Info    Potassium channel toxin alpha-KTx 4.8 Dissociation constant
65 nM
[10]
 Toxin Info    Potassium channel toxin alpha-KTx 24.1 Dissociation constant
92 nM
[11]
 Toxin Info    Toxin VmKTx1 Dissociation constant
7.1 μM
[12]
 Toxin Info    Toxin VmKTx1 Dissociation constant
7.1 μM
[12], [13]
 Toxin Info    Anuroctoxin (N17A,F32T) Dissociation constant
9.6 μM
[8]
 Toxin Info    Kappa-actitoxin-Bgr1a Inhibition constant
0.066 nM
[1]
 Toxin Info    Bgk (W5Y,Y26F) Inhibition constant
0.369 nM
[1]
 Toxin Info    Kappa-stichotoxin-Hmg1a Inhibition constant
2.5 nM
[14]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) Inhibition constant
20.75 nM
[15]
 Toxin Info    Bgk (W5Y,F6A,Y26F) Inhibition constant
289.2 nM
[1]
 Toxin Info    Kappa-actitoxin-Aer3a Inhibition constant
2.243 μM
[14]
 Toxin Info    Toxin MeKTx13-3 (D19K) Inhibition rate . [16]
 Toxin Info    Toxin MeKTx13-3 (G11R,I28T,D33H) Inhibition rate . [17]
 Toxin Info    Toxin MeKTx13-3 (K6D,D19K) Inhibition rate . [16]
 Toxin Info    Toxin MeKTx13-3 (K6T,K8N,H9E,G11R,L14Y,K15N,K18G,M22Y,R23P,I28T,N29Y,D33H,T35K,K37Q) Inhibition rate . [18]
 Toxin Info    Anuroctoxin (F32T) Inhibition rate . [8]
 Toxin Info    Kappa-conotoxin ViTx Inhibition rate . [19], [20]
 Toxin Info    Scorpine-like peptide Ev37 Inhibition rate . [21]
 Toxin Info    U-actitoxin-Avd3n Inhibition rate . [22]
 Toxin Info    Defensin domain protein Inhibition rate . [23]
 Toxin Info    U-actitoxin-Oulsp2 Inhibition rate . [24]
 Toxin Info    Beta/omega-theraphotoxin-Tp2a Inhibition rate . [25- 44]
 Toxin Info    Kunitz-type serine protease inhibitor homolog dendrotoxin K Inhibition rate . [45]
 Toxin Info    Potassium channel gamma toxin gamma-KTx 1.9 Inhibition rate . [46]
 Toxin Info    Contryphan-Vn Inhibition rate . [47], [48], [49]
 Toxin Info    Beta-defensin 104 Inhibition rate . [50]
 Toxin Info    OsK1 (E16K,K20D) Inhibition rate . [51]
 Toxin Info    Kappa-theraphotoxin-Pg1a Inhibition rate . [52], [53], [54], [55]
 Toxin Info    Kunitz-type serine protease inhibitor Hg1 Inhibition rate
<50 %
[56], [57]
 Toxin Info    BmK86-P9 Inhibition rate
1.8 %
[58]
 Toxin Info    Neurotoxin BmK86 (K19A) Inhibition rate
2 %
[58]
 Toxin Info    Kcug1 (C1K,T2C,A3T,S4A,K5S,Q6K,C7Q,W8C,P9W,V10P,C11V,N12C,Q13N,M14Q,F15M,G16F,K17G,P18K,N19P,G20N,K21G,C22K,M23C,N24M,G25N,K26G,C27K,R28C,C29R) Inhibition rate
2 %
[59]
 Toxin Info    Kcug1 (K27A) Inhibition rate
2.4 %
[59]
 Toxin Info    Kcug1 (C1T,T2D,A3V,S4K,K5C,Q6T,C7A,W8S,P9K,V10Q,N12W,Q13P,M14V,F15C,G16N,K17Q,P18M,N19F,C22P,M23N,N24G,G25K,K26C,C27M,R28N,C29G) Inhibition rate
2.4 %
[59]
 Toxin Info    Conotoxin PlXIVA Inhibition rate
2.5 %
[58]
 Toxin Info    Neurotoxin BmK86 (I21A) Inhibition rate
3 %
[58]
 Toxin Info    Kappa-HfTx2 Inhibition rate
3.2 %
[59]
 Toxin Info    Fungal defensin plectasin Inhibition rate
4 %
[60]
 Toxin Info    Beta/omega-theraphotoxin-Tp1a Inhibition rate
6 %
[25- 64]
 Toxin Info    Potassium channel toxin Sp4 Inhibition rate
7 %
[65]
 Toxin Info    Neutrophil defensin 1 Inhibition rate
7 %
[66]
 Toxin Info    Defensin alpha 5 Inhibition rate
7 %
[66]
 Toxin Info    Beta-defensin 3 Inhibition rate
9 %
[67]
 Toxin Info    Potassium channel toxin alpha-KTx 23.2 Inhibition rate
9.8 %
[68]
 Toxin Info    Defensin BmKDfsin5 Inhibition rate
10 %
[69]
 Toxin Info    Kunitz-type serine protease inhibitor HCRG21 Inhibition rate
11 %
[70]
 Toxin Info    Beta-defensin 1 Inhibition rate
13 %
[71]
 Toxin Info    Defensin beta 4A Inhibition rate
16 %
[72]
 Toxin Info    Neurotoxin BmK86 (N17A) Inhibition rate
25 %
[58]
 Toxin Info    Kcug1 (Y36A) Inhibition rate
26.3 %
[59]
 Toxin Info    Defensin BmKDfsin3 Inhibition rate
28 %
[69- 73]
 Toxin Info    Neurotoxin BmK86 (R24A) Inhibition rate
30 %
[58]
 Toxin Info    Potassium channel toxin kappa-KTx 2.9 Inhibition rate
31 %
[11]
 Toxin Info    Defensin BmKDfsin4 Inhibition rate
31 %
[74]
 Toxin Info    Defensin domain protein Inhibition rate
33 %
[23]
 Toxin Info    Potassium channel toxin KTx1 Inhibition rate
42 %
[75]
 Toxin Info    Potassium channel toxin KTx1 Inhibition rate
42 %
[75]
 Toxin Info    Beta-defensin 103 Inhibition rate
51 %
[50]
 Toxin Info    Kcug1 (M29A) Inhibition rate
64.9 %
[59]
 Toxin Info    Kcug1 (N30A) Inhibition rate
71.8 %
[59]
 Toxin Info    Kappa-buthitoxin-Tt2b Inhibition rate
75 %
[76]
 Toxin Info    Kcug1 (N25A) Inhibition rate
78.7 %
[59]
 Toxin Info    Kcug1 (R34A) Inhibition rate
78.7 %
[59]
 Toxin Info    Kcug1 (K32A) Inhibition rate
82.5 %
[59]
 Toxin Info    Kcug1 (S10A) Inhibition rate
84.1 %
[59]
 Toxin Info    Kcug1 (Q12A) Inhibition rate
87.2 %
[59]
 Toxin Info    Kcug1 (K11A) Inhibition rate
88.1 %
[59]
 Toxin Info    ChTx-b IC50
6 pM
[77]
 Toxin Info    Potassium channel toxin alpha-KTx 6.21 IC50
0.11 - 0.16 nM
[78], [79]
 Toxin Info    Potassium channel toxin alpha-KTx 6.21 IC50
0.16 nM
[78]
 Toxin Info    Uro (T19Q) IC50
0.244 nM
[79]
 Toxin Info    Potassium channel toxin alpha-KTx 2.15 IC50
0.3 nM
[46]
 Toxin Info    Potassium channel toxin alpha-KTx 2.15 IC50
0.3 nM
[46]
 Toxin Info    Potassium channel toxin alpha-KTx 2.16 IC50
0.7 nM
[46]
 Toxin Info    Potassium channel toxin alpha-KTx 2.16 IC50
0.7 nM
[46]
 Toxin Info    Neurotoxin HsTX1 (R14A) IC50
0.863 nM
[80]
 Toxin Info    Potassium channel toxin alpha-KTx 2.13 IC50
1.3 nM
[81]
 Toxin Info    Potassium channel toxin alpha-KTx 2.17 IC50
2.9 nM
[46]
 Toxin Info    Potassium channel toxin alpha-KTx 2.17 IC50
2.9 nM
[46]
 Toxin Info    OsK1 (E16K,K20D) IC50
2.96 nM
[82]
 Toxin Info    Potassium channel toxin alpha-KTx 10.4 IC50
3.6 nM
[46]
 Toxin Info    Potassium channel toxin alpha-KTx 10.4 IC50
3.6 nM
[46]
 Toxin Info    OsK1 (E16K) IC50
5.23 nM
[82]
 Toxin Info    Potassium channel toxin alpha-KTx 3.7 IC50
5.4 nM
[82]
 Toxin Info    Potassium channel toxin alpha-KTx J123 IC50
26.4 nM
[83]
 Toxin Info    BmK86-P1 IC50
28.5 nM
[58]
 Toxin Info    OsK1 (E15K,K19D) IC50
30 nM
[51]
 Toxin Info    Kappa-conotoxin RIIIJ IC50
33 nM
[84]
 Toxin Info    Potassium channel toxin alpha-KTx 1.15 IC50
46 nM
[59]
 Toxin Info    Kappa-M-RIIIJ (K10R,H11L) IC50
48 nM
[84]
 Toxin Info    Kappa-M-RIIIJ (T6S,P7L,P8N) IC50
67 nM
[84]
 Toxin Info    OsK1 (K20D) IC50
77.8 nM
[82]
 Toxin Info    Kcug1 (C1V,T2K,A3C,S4T,K5A,Q6S,C7K,W8Q,P9C,V10W,C11P,N12V,Q13C,M14N,F15Q,G16M,K17F,P18G,N19K,G20P,K21N,C22G,M23K,N24C,G25M,K26N,C27G,R28K) IC50
89.9 nM
[59]
 Toxin Info    Kappa-conotoxin RIIIJ IC50
98.3 nM
[85]
 Toxin Info    OsK1 (V1T,E15K,K19D) IC50
100 nM
[51]
 Toxin Info    Conotoxin R3.1 (L9K) IC50
102 nM
[84]
 Toxin Info    MTX (K23A) IC50
170 nM
[86]
 Toxin Info    PI-stichotoxin-Hcr2g IC50
181.7 nM
[70]
 Toxin Info    PI-stichotoxin-Hcr2g IC50
181.7 nM
[70- 88]
 Toxin Info    MTX (Y32A) IC50
190 nM
[86]
 Toxin Info    OsK1 (E16K,K20D) IC50
196 nM
[82]
 Toxin Info    OsK1 (E16K,K20D,T36Y) IC50
232 nM
[82]
 Toxin Info    Kappa-M-RIIIJ (K9L,K10R,H11L) IC50
336 nM
[84]
 Toxin Info    Kappa-conotoxin RIIIK IC50
352 nM
[84]
 Toxin Info    Kappa-M-RIIIJ (T6S,P7L,P8N,K9L,K10R,H11L) IC50
374 nM
[84]
 Toxin Info    ([20kDa-PEG] -(Lys16)-ShK IC50
639 nM
[89]
 Toxin Info    Kunitz-type serine protease inhibitor Hg1 IC50
1 μM
[57]
 Toxin Info    Kunitz-type conkunitzin-S1 IC50
3.4 μM
[90], [91], [92]
 Toxin Info    Kunitz-type conkunitzin-S1 IC50
4.18 μM
[90], [91], [92]
 Toxin Info    Uro IC50
8 μM
[79]
 Toxin Info    Uro (K25A) IC50
13.1 μM
[79]
 Toxin Info    PI-stichotoxin-Hcr2f IC50
52 μM
[70- 88]
 Toxin Info    PI-stichotoxin-Hcr2f IC50
52.199 μM
[70]
References
Ref 1 Characterization of a novel radiolabeled peptide selective for a subpopulation of voltage-gated potassium channels in mammalian brain. J Biol Chem. 2002 Feb 8;277(6):3886-93. doi: 10.1074/jbc.M109886200. Epub 2001 Nov 13.
Ref 2 Margatoxin is a non-selective inhibitor of human Kv1.3 K+ channels. Toxicon. 2014 Sep;87:6-16. doi: 10.1016/j.toxicon.2014.05.002. Epub 2014 May 28.
Ref 3 Vm24, a natural immunosuppressive peptide, potently and selectively blocks Kv1.3 potassium channels of human T cells. Mol Pharmacol. 2012 Sep;82(3):372-82. doi: 10.1124/mol.112.078006. Epub 2012 May 23.
Ref 4 Cm28, a scorpion toxin having a unique primary structure, inhibits KV1.2 and KV1.3 with high affinity. J Gen Physiol. 2022 Aug 1;154(8):e202213146. doi: 10.1085/jgp.202213146. Epub 2022 Jun 14.
Ref 5 Tst26, a novel peptide blocker of Kv1.2 and Kv1.3 channels from the venom of Tityus stigmurus. Toxicon. 2009 Sep 15;54(4):379-89. doi: 10.1016/j.toxicon.2009.05.023. Epub 2009 Jun 3.
Ref 6 Anuroctoxin, a new scorpion toxin of the alpha-KTx 6 subfamily, is highly selective for Kv1.3 over IKCa1 ion channels of human T lymphocytes. Mol Pharmacol. 2005 Apr;67(4):1034-44. doi: 10.1124/mol.104.007187. Epub 2004 Dec 22.
Ref 7 A potassium-channel toxin from the sea anemone Bunodosoma granulifera, an inhibitor for Kv1 channels. Revision of the amino acid sequence, disulfide-bridge assignment, chemical synthesis, and biological activity. Eur J Biochem. 1997 Feb 15;244(1):192-202. doi: 10.1111/j.1432-1033.1997.00192.x.
Ref 8 An engineered scorpion toxin analogue with improved Kv1.3 selectivity displays reduced conformational flexibility. Sci Rep. 2015 Dec 22;5:18397. doi: 10.1038/srep18397.
Ref 9 Role of disulfide bonds in the structure and potassium channel blocking activity of ShK toxin. Biochemistry. 1999 Nov 2;38(44):14549-58. doi: 10.1021/bi991282m.
Ref 10 Characterization and Chemical Synthesis of Cm39 (-KTx 4.8): A Scorpion Toxin That Inhibits Voltage-Gated K(+) Channel K(V)1.2 and Small- and Intermediate-Conductance Ca(2+)-Activated K(+) Channels K(Ca)2.2 and K(Ca)3.1. Toxins (Basel). 2023 Jan 5;15(1):41. doi: 10.3390/toxins15010041.
Ref 11 Pi5 and Pi6, two undescribed peptides from the venom of the scorpion Pandinus imperator and their effects on K(+)-channels. Toxicon. 2017 Jul;133:136-144. doi: 10.1016/j.toxicon.2017.05.011. Epub 2017 May 11.
Ref 12 sVmKTx, a transcriptome analysis-based synthetic peptide analogue of Vm24, inhibits Kv1.3 channels of human T cells with improved selectivity. Biochem Pharmacol. 2022 May;199:115023. doi: 10.1016/j.bcp.2022.115023. Epub 2022 Mar 28.
Ref 13 Transcriptome analysis of scorpion species belonging to the Vaejovis genus. PLoS One. 2015 Feb 6;10(2):e0117188. doi: 10.1371/journal.pone.0117188. eCollection 2015.
Ref 14 Designer and natural peptide toxin blockers of the KcsA potassium channel identified by phage display. Proc Natl Acad Sci U S A. 2015 Dec 15;112(50):E7013-21. doi: 10.1073/pnas.1514728112. Epub 2015 Dec 1.
Ref 15 Substitution of a single residue in Stichodactyla helianthus peptide, ShK-Dap22, reveals a novel pharmacological profile. Biochemistry. 2003 Nov 25;42(46):13698-707. doi: 10.1021/bi035209e.
Ref 16 Toxin acidic residue evolutionary function-guided design of de novo peptide drugs for the immunotherapeutic target, the Kv1.3 channel. Sci Rep. 2015 May 8;5:9881. doi: 10.1038/srep09881.
Ref 17 Structural basis of a potent peptide inhibitor designed for Kv1.3 channel, a therapeutic target of autoimmune disease. J Biol Chem. 2008 Jul 4;283(27):19058-65. doi: 10.1074/jbc.M802054200. Epub 2008 May 14.
Ref 18 Engineering a peptide inhibitor towards the KCNQ1/KCNE1 potassium channel (IKs). Peptides. 2015 Sep;71:77-83. doi: 10.1016/j.peptides.2015.07.002. Epub 2015 Jul 15.
Ref 19 A novel conotoxin inhibiting vertebrate voltage-sensitive potassium channels. Toxicon. 2003 Jul;42(1):43-52. doi: 10.1016/s0041-0101(03)00099-0.
Ref 20 Novel conopeptides of the I-superfamily occur in several clades of cone snails. Toxicon. 2004 Oct;44(5):539-48. doi: 10.1016/j.toxicon.2004.07.006.
Ref 21 Expression and characterization of a novel scorpine-like peptide Ev37, from the scorpion Euscorpiops validus. Protein Expr Purif. 2013 Mar;88(1):127-33. doi: 10.1016/j.pep.2012.12.004. Epub 2012 Dec 20.
Ref 22 AsKC11, a Kunitz Peptide from Anemonia sulcata, Is a Novel Activator of G Protein-Coupled Inward-Rectifier Potassium Channels. Mar Drugs. 2022 Feb 15;20(2):140. doi: 10.3390/md20020140.
Ref 23 Genome and Transcriptome Sequences Reveal the Specific Parasitism of the Nematophagous Purpureocillium lilacinum 36-1. Front Microbiol. 2016 Jul 19;7:1084. doi: 10.3389/fmicb.2016.01084. eCollection 2016.
Ref 24 Synthesis, folding, structure and activity of a predicted peptide from the sea anemone Oulactis sp. with an ShKT fold. Toxicon. 2018 Aug;150:50-59. doi: 10.1016/j.toxicon.2018.05.006. Epub 2018 May 19.
Ref 25 Two tarantula peptides inhibit activation of multiple sodium channels. Biochemistry. 2002 Dec 17;41(50):14734-47. doi: 10.1021/bi026546a.
Ref 26 Differential phospholipid binding by site 3 and site 4 toxins. Implications for structural variability between voltage-sensitive sodium channel domains. J Biol Chem. 2005 Mar 25;280(12):11127-33. doi: 10.1074/jbc.M412552200. Epub 2005 Jan 4.
Ref 27 Molecular interactions of the gating modifier toxin ProTx-II with NaV 1.5: implied existence of a novel toxin binding site coupled to activation. J Biol Chem. 2007 Apr 27;282(17):12687-97. doi: 10.1074/jbc.M610462200. Epub 2007 Mar 5.
Ref 28 ProTx-I and ProTx-II: gating modifiers of voltage-gated sodium channels. Toxicon. 2007 Feb;49(2):194-201. doi: 10.1016/j.toxicon.2006.09.014. Epub 2006 Sep 27.
Ref 29 Inhibition of sodium channel gating by trapping the domain II voltage sensor with protoxin II. Mol Pharmacol. 2008 Mar;73(3):1020-8. doi: 10.1124/mol.107.041046. Epub 2007 Dec 21.
Ref 30 ProTx-II, a selective inhibitor of NaV1.7 sodium channels, blocks action potential propagation in nociceptors. Mol Pharmacol. 2008 Nov;74(5):1476-84. doi: 10.1124/mol.108.047670. Epub 2008 Aug 26.
Ref 31 Evidence for multiple effects of ProTxII on activation gating in Na(V)1.5. Toxicon. 2008 Sep 1;52(3):489-500. doi: 10.1016/j.toxicon.2008.06.023. Epub 2008 Jul 9.
Ref 32 The tarantula toxins ProTx-II and huwentoxin-IV differentially interact with human Nav1.7 voltage sensors to inhibit channel activation and inactivation. Mol Pharmacol. 2010 Dec;78(6):1124-34. doi: 10.1124/mol.110.066332. Epub 2010 Sep 20.
Ref 33 Inhibition of the activation pathway of the T-type calcium channel Ca(V)3.1 by ProTxII. Toxicon. 2010 Sep 15;56(4):624-36. doi: 10.1016/j.toxicon.2010.06.009. Epub 2010 Jun 23.
Ref 34 Crystallographic insights into sodium-channel modulation by the 4 subunit. Proc Natl Acad Sci U S A. 2013 Dec 17;110(51):E5016-24. doi: 10.1073/pnas.1314557110. Epub 2013 Dec 2.
Ref 35 Block of T-type calcium channels by protoxins I and II. Mol Brain. 2014 May 9;7:36. doi: 10.1186/1756-6606-7-36.
Ref 36 High Proteolytic Resistance of Spider-Derived Inhibitor Cystine Knots. Int J Pept. 2015;2015:537508. doi: 10.1155/2015/537508. Epub 2015 Dec 30.
Ref 37 Engineering potent and selective analogues of GpTx-1, a tarantula venom peptide antagonist of the Na(V)1.7 sodium channel. J Med Chem. 2015 Mar 12;58(5):2299-314. doi: 10.1021/jm501765v. Epub 2015 Feb 19.
Ref 38 Binary architecture of the Nav1.2-2 signaling complex. Elife. 2016 Feb 19;5:e10960. doi: 10.7554/eLife.10960.
Ref 39 Insensitivity to pain induced by a potent selective closed-state Nav1.7 inhibitor. Sci Rep. 2017 Jan 3;7:39662. doi: 10.1038/srep39662.
Ref 40 Chemical Synthesis, Proper Folding, Na(v) Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. doi: 10.3390/toxins11060367.
Ref 41 Studies examining the relationship between the chemical structure of protoxin II and its activity on voltage gated sodium channels. J Med Chem. 2014 Aug 14;57(15):6623-31. doi: 10.1021/jm500687u. Epub 2014 Jul 24.
Ref 42 Interaction of Tarantula Venom Peptide ProTx-II with Lipid Membranes Is a Prerequisite for Its Inhibition of Human Voltage-gated Sodium Channel NaV1.7. J Biol Chem. 2016 Aug 12;291(33):17049-65. doi: 10.1074/jbc.M116.729095. Epub 2016 Jun 16.
Ref 43 Structural Basis of Nav1.7 Inhibition by a Gating-Modifier Spider Toxin. Cell. 2019 Feb 7;176(4):702-715.e14. doi: 10.1016/j.cell.2018.12.018. Epub 2019 Jan 17.
Ref 44 Structures of human Na(v)1.7 channel in complex with auxiliary subunits and animal toxins. Science. 2019 Mar 22;363(6433):1303-1308. doi: 10.1126/science.aaw2493. Epub 2019 Feb 14.
Ref 45 Novel effects of dendrotoxin homologues on subtypes of mammalian Kv1 potassium channels expressed in Xenopus oocytes. FEBS Lett. 1996 Mar 25;383(1-2):26-30. doi: 10.1016/0014-5793(96)00211-6.
Ref 46 Isolation, chemical and functional characterization of several new K(+)-channel blocking peptides from the venom of the scorpion Centruroides tecomanus. Toxicon. 2016 Jun 1;115:1-12. doi: 10.1016/j.toxicon.2016.02.017. Epub 2016 Feb 26.
Ref 47 Contryphan-Vn: a novel peptide from the venom of the Mediterranean snail Conus ventricosus. Biochem Biophys Res Commun. 2001 Nov 9;288(4):908-13. doi: 10.1006/bbrc.2001.5833.
Ref 48 Contryphan-Vn: a modulator of Ca2+-dependent K+ channels. Biochem Biophys Res Commun. 2003 Mar 28;303(1):238-46. doi: 10.1016/s0006-291x(03)00331-0.
Ref 49 Solution structure of the cyclic peptide contryphan-Vn, a Ca2+-dependent K+ channel modulator. Biopolymers. 2004 Jun 15;74(3):189-98. doi: 10.1002/bip.20025.
Ref 50 Pharmacological characterization of human beta-defensins 3 and 4 on potassium channels: Evidence of diversity in beta-defensin-potassium channel interactions. Peptides. 2018 Oct;108:14-18. doi: 10.1016/j.peptides.2018.08.005. Epub 2018 Aug 16.
Ref 51 Pharmacological profiling of Orthochirus scrobiculosus toxin 1 analogs with a trimmed N-terminal domain. Mol Pharmacol. 2006 Jan;69(1):354-62. doi: 10.1124/mol.105.017210. Epub 2005 Oct 18.
Ref 52 Blockers of the delayed-rectifier potassium current in pancreatic beta-cells enhance glucose-dependent insulin secretion. Diabetes. 2006 Apr;55(4):1034-42. doi: 10.2337/diabetes.55.04.06.db05-0788.
Ref 53 Gating modifier peptides as probes of pancreatic beta-cell physiology. Toxicon. 2007 Feb;49(2):231-8. doi: 10.1016/j.toxicon.2006.09.012. Epub 2006 Sep 23.
Ref 54 A KV2.1 gating modifier binding assay suitable for high throughput screening. Channels (Austin). 2009 Nov;3(6):437-47. doi: 10.4161/chan.3.6.10201.
Ref 55 Solution structure of GxTX-1E, a high-affinity tarantula toxin interacting with voltage sensors in Kv2.1 potassium channels. Biochemistry. 2010 Jun 29;49(25):5134-42. doi: 10.1021/bi100246u.
Ref 56 Transcriptome analysis of the venom gland of the Mexican scorpion Hadrurus gertschi (Arachnida: Scorpiones). BMC Genomics. 2007 May 16;8:119. doi: 10.1186/1471-2164-8-119.
Ref 57 Hg1, novel peptide inhibitor specific for Kv1.3 channels from first scorpion Kunitz-type potassium channel toxin family. J Biol Chem. 2012 Apr 20;287(17):13813-21. doi: 10.1074/jbc.M112.343996. Epub 2012 Feb 21.
Ref 58 BmK86-P1, a New Degradation Peptide with Desirable Thermostability and Kv1.2 Channel-Specific Activity from Traditional Chinese Scorpion Medicinal Material. Toxins (Basel). 2021 Aug 30;13(9):610. doi: 10.3390/toxins13090610.
Ref 59 Different pharmacological properties between scorpion toxin BmKcug2 and its degraded analogs highlight the diversity of K(+) channel blockers from thermally processed scorpions. Int J Biol Macromol. 2021 May 1;178:143-153. doi: 10.1016/j.ijbiomac.2021.02.155. Epub 2021 Feb 23.
Ref 60 Plectasin, first animal toxin-like fungal defensin blocking potassium channels through recognizing channel pore region. Toxins (Basel). 2015 Jan 5;7(1):34-42. doi: 10.3390/toxins7010034.
Ref 61 Tarantula toxin ProTx-I differentiates between human T-type voltage-gated Ca2+ Channels Cav3.1 and Cav3.2. J Pharmacol Sci. 2010;112(4):452-8. doi: 10.1254/jphs.09356fp. Epub 2010 Mar 30.
Ref 62 Gating modifier toxins isolated from spider venom: Modulation of voltage-gated sodium channels and the role of lipid membranes. J Biol Chem. 2018 Jun 8;293(23):9041-9052. doi: 10.1074/jbc.RA118.002553. Epub 2018 Apr 27.
Ref 63 Mutational analysis of ProTx-I and the novel venom peptide Pe1b provide insight into residues responsible for selective inhibition of the analgesic drug target Na(V)1.7. Biochem Pharmacol. 2020 Nov;181:114080. doi: 10.1016/j.bcp.2020.114080. Epub 2020 Jun 6.
Ref 64 A tarantula-venom peptide antagonizes the TRPA1 nociceptor ion channel by binding to the S1-S4 gating domain. Curr Biol. 2014 Mar 3;24(5):473-83. doi: 10.1016/j.cub.2014.01.013. Epub 2014 Feb 13.
Ref 65 Cloning, expression and identification of KTX-Sp4, a selective Kv1.3 peptidic blocker from Scorpiops pococki. Cell Biosci. 2017 Nov 6;7:60. doi: 10.1186/s13578-017-0187-x. eCollection 2017.
Ref 66 Human -defensins are immune-related Kv1.3 channel inhibitors: new support for their roles in adaptive immunity. FASEB J. 2015 Oct;29(10):4324-33. doi: 10.1096/fj.15-274787. Epub 2015 Jul 6.
Ref 67 Mouse -Defensin 3, A Defensin Inhibitor of Both Its Endogenous and Exogenous Potassium Channels. Molecules. 2018 Jun 20;23(6):1489. doi: 10.3390/molecules23061489.
Ref 68 Vm23 and vm24, two scorpion peptides that block human t-lymphocyte potassium channels (sub-type kv1.3) with high selectivity and decrease the in vivo dth-responses in rats.
Ref 69 Ion channel modulation by scorpion hemolymph and its defensin ingredients highlights origin of neurotoxins in telson formed in Paleozoic scorpions. Int J Biol Macromol. 2020 Apr 1;148:351-363. doi: 10.1016/j.ijbiomac.2020.01.133. Epub 2020 Jan 15.
Ref 70 Kunitz-Type Peptides from the Sea Anemone Heteractis crispa Demonstrate Potassium Channel Blocking and Anti-Inflammatory Activities. Biomedicines. 2020 Nov 4;8(11):473. doi: 10.3390/biomedicines8110473.
Ref 71 Human beta-defensin 1, a new animal toxin-like blocker of potassium channel. Toxicon. 2016 Apr;113:1-6. doi: 10.1016/j.toxicon.2016.02.007. Epub 2016 Feb 5.
Ref 72 Endogenous animal toxin-like human -defensin 2 inhibits own K(+) channels through interaction with channel extracellular pore region. Cell Mol Life Sci. 2015 Feb;72(4):845-53. doi: 10.1007/s00018-014-1715-z. Epub 2014 Sep 20.
Ref 73 The genome of Mesobuthus martensii reveals a unique adaptation model of arthropods. Nat Commun. 2013;4:2602. doi: 10.1038/ncomms3602.
Ref 74 Scorpion Potassium Channel-blocking Defensin Highlights a Functional Link with Neurotoxin. J Biol Chem. 2016 Mar 25;291(13):7097-106. doi: 10.1074/jbc.M115.680611. Epub 2016 Jan 27.
Ref 75 ImKTx1, a new Kv1.3 channel blocker with a unique primary structure. J Biochem Mol Toxicol. 2011 Jul-Aug;25(4):244-51. doi: 10.1002/jbt.20382. Epub 2011 Feb 9.
Ref 76 New tricks of an old pattern: structural versatility of scorpion toxins with common cysteine spacing. J Biol Chem. 2012 Apr 6;287(15):12321-30. doi: 10.1074/jbc.M111.329607. Epub 2012 Jan 10.
Ref 77 Gigolaev, A. M., et al. "KV1. 2-Selective Peptide with High Affinity."?Journal of Evolutionary Biochemistry and Physiology?58.6 (2022): 2048-2057.
Ref 78 Structure, molecular modeling, and function of the novel potassium channel blocker urotoxin isolated from the venom of the Australian scorpion Urodacus yaschenkoi. Mol Pharmacol. 2014 Jul;86(1):28-41. doi: 10.1124/mol.113.090183. Epub 2014 Apr 10.
Ref 79 Structural basis of the potency and selectivity of Urotoxin, a potent Kv1 blocker from scorpion venom. Biochem Pharmacol. 2020 Apr;174:113782. doi: 10.1016/j.bcp.2019.113782. Epub 2019 Dec 25.
Ref 80 A Fluorescent Peptide Toxin for Selective Visualization of the Voltage-Gated Potassium Channel K(V)1.3. Bioconjug Chem. 2022 Nov 16;33(11):2197-2212. doi: 10.1021/acs.bioconjchem.2c00436. Epub 2022 Nov 4.
Ref 81 A selective blocker of Kv1.2 and Kv1.3 potassium channels from the venom of the scorpion Centruroides suffusus suffusus. Biochem Pharmacol. 2008 Oct 30;76(9):1142-54. doi: 10.1016/j.bcp.2008.08.018. Epub 2008 Aug 22.
Ref 82 K+ channel types targeted by synthetic OSK1, a toxin from Orthochirus scrobiculosus scorpion venom. Biochem J. 2005 Jan 1;385(Pt 1):95-104. doi: 10.1042/BJ20041379.
Ref 83 Characterization of a new Kv1.3 channel-specific blocker, J123, from the scorpion Buthus martensii Karsch. Peptides. 2008 Sep;29(9):1514-20. doi: 10.1016/j.peptides.2008.04.021. Epub 2008 May 13.
Ref 84 Biochemical characterization of kappaM-RIIIJ, a Kv1.2 channel blocker: evaluation of cardioprotective effects of kappaM-conotoxins. J Biol Chem. 2010 May 14;285(20):14882-14889. doi: 10.1074/jbc.M109.068486. Epub 2010 Mar 10.
Ref 85 Conotoxin M-RIIIJ, a tool targeting asymmetric heteromeric K(v)1 channels. Proc Natl Acad Sci U S A. 2019 Jan 15;116(3):1059-1064. doi: 10.1073/pnas.1813161116. Epub 2018 Dec 28.
Ref 86 The 'functional' dyad of scorpion toxin Pi1 is not itself a prerequisite for toxin binding to the voltage-gated Kv1.2 potassium channels. Biochem J. 2004 Jan 1;377(Pt 1):25-36. doi: 10.1042/BJ20030115.
Ref 87 New Kunitz-Type HCRG Polypeptides from the Sea Anemone Heteractis crispa. Mar Drugs. 2015 Sep 24;13(10):6038-63. doi: 10.3390/md13106038.
Ref 88 Sea Anemone Kunitz-Type Peptides Demonstrate Neuroprotective Activity in the 6-Hydroxydopamine Induced Neurotoxicity Model. Biomedicines. 2021 Mar 10;9(3):283. doi: 10.3390/biomedicines9030283.
Ref 89 Pharmaceutical Optimization of Peptide Toxins for Ion Channel Targets: Potent, Selective, and Long-Lived Antagonists of Kv1.3. J Med Chem. 2015 Sep 10;58(17):6784-802. doi: 10.1021/acs.jmedchem.5b00495. Epub 2015 Aug 31.
Ref 90 Production of recombinant Conkunitzin-S1 in Escherichia coli. Protein Expr Purif. 2006 Jun;47(2):640-4. doi: 10.1016/j.pep.2006.01.019. Epub 2006 Feb 20.
Ref 91 Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family. Structural and functional characterization. J Biol Chem. 2005 Jun 24;280(25):23766-70. doi: 10.1074/jbc.C500064200. Epub 2005 Apr 15.
Ref 92 Structure of conkunitzin-S1, a neurotoxin and Kunitz-fold disulfide variant from cone snail. Acta Crystallogr D Biol Crystallogr. 2006 Sep;62(Pt 9):980-90. doi: 10.1107/S0907444906021123. Epub 2006 Aug 19.
Ref 93 Venom composition and pain-causing toxins of the Australian great carpenter bee Xylocopa aruana. Sci Rep. 2022 Dec 22;12(1):22168. doi: 10.1038/s41598-022-26867-8.
Ref 94 Mechanisms Underlying the Inhibition of KV1.3 Channel by Scorpion Toxin ImKTX58. Mol Pharmacol. 2022 Sep;102(3):150-160. doi: 10.1124/molpharm.121.000480. Epub 2022 Jun 28.
Ref 95 ImKTx96, a peptide blocker of the Kv1.2 ion channel from the venom of the scorpion Isometrus maculates. Peptides. 2020 Jan;123:170172. doi: 10.1016/j.peptides.2019.170172. Epub 2019 Oct 15.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.