Target Information

General Information of This Target

Target ID	BTDT00141
Target Name	Sodium channel protein type 9 subunit alpha (SCN9A)
Target Bioclass	Transporter and channel
Uniprot ID	Q15858
3D Structure	Download 2D Sequence Download FASTA 3D Structure Download PDB Source Predict by Alphafold2 ? Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name	SCN9A
Gene ID	6335
Synonym	NENA; Neuroendocrine sodium channel; Peripheral sodium channel 1; Sodium channel protein type IX subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.7
Sequence	MAMLPPPGPQSFVHFTKQSLALIEQRIAERKSKEPKEEKKDDDEEAPKPSSDLEAGKQLP FIYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISI KILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGE FTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQ SVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFR KYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQ DYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQKE LEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRNRR KKKNQKKLSSGEEKGDAEKLSKSESEDSIRRKSFHLGVEGHRRAHEKRLSTPNQSPLSIR GSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRRGSLFVPHRPQERRSS NISQASRSPPMLPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKATSDDSGT TNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHK FLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGN LVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLL RVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIN DDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVL NLFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKI SREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFI HNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEE AEAEPMNSDEPEACFTDGCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVL MILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCW LDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPS IMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNV RWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVF IIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRP GNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTG ECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRI LRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFN FETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYF VSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFS KLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLR SQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKDG DRDDDLLNKKDMAFDNVNENSSPEKTDATSSTTSPPSYDSVTKPDKEKYEQDRTEKEDKG KDSKESKK Click to Show/Hide
Family	the sodium channel (TC 1.A.1.10) family
Function	Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na(+) channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain. Click to Show/Hide
Taxonomy ID	9606
TCDB ID	1.A.1.10.5
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Toxin Information Related to This Target

Toxin Name	Activity Data Type	Activity Data	Reference
Toxin Info Kappa-actitoxin-Avd4a	Effective concentration 50	3 nM	[1- 5]
Toxin Info Delta/kappa-actitoxin-Avd4a	Effective concentration 50	3 nM	[4- 10]
Toxin Info Alpha-mammal toxin AaH2	Effective concentration 50	6.8 nM	[11- 20]
Toxin Info Alpha-mammal toxin AnCra1	Effective concentration 50	136.7 nM	[21]
Toxin Info Nemertide alpha-2	Effective concentration 50	1.2967 μM	[22], [23]
Toxin Info Delta-conotoxin PVIA	Effective concentration 50	1.9 μM	[24], [25], [26], [27]
Toxin Info O- MrVIA	IC50	5.5 ± 0.9 mM	[28]
Toxin Info AM-8145-6	IC50	0.2 nM	[29]
Toxin Info AM-8145-9	IC50	0.2 nM	[29]
Toxin Info Pn3a-D8N	IC50	0.2 nM	[30]
Toxin Info AM-8145-22	IC50	0.26 nM	[29]
Toxin Info AM-2752	IC50	0.3 nM	[29]
Toxin Info AM-5695	IC50	0.3 nM	[29]
Toxin Info AM-8145-33	IC50	0.3 nM	[29]
Toxin Info AM-8145-7	IC50	0.3 nM	[29]
Toxin Info Pn3a-D1K	IC50	0.3 nM	[30]
Toxin Info Pn3a-D8K	IC50	0.3 nM	[30]
Toxin Info AM-8145	IC50	0.5 nM	[29]
Toxin Info AM-8145-37	IC50	0.5 nM	[29]
Toxin Info AM-8145-4	IC50	0.5 nM	[29]
Toxin Info AM-8145-14	IC50	0.6 nM	[29]
Toxin Info AM-8145-8	IC50	0.6 nM	[29]
Toxin Info JZTx-V	IC50	0.6 nM	[29]
Toxin Info E1A,E4A,Y33W	IC50	0.6 ± 0.1 nM	[31]
Toxin Info AM0422	IC50	0.8 nM	[29]
Toxin Info AM-6120	IC50	0.8 nM	[29]
Toxin Info HwTx-IV (E1G,E4G,K18A)	IC50	0.8 ± 1.1 nM	[31]
Toxin Info HwTx-IV (E4K,R26A,Y33W)	IC50	0.9 ± 1.1 nM	[31]
Toxin Info AM-1647	IC50	1 nM	[29]
Toxin Info AM-8145-32	IC50	1 nM	[29]
Toxin Info AM-8145-34	IC50	1 nM	[29]
Toxin Info Pn3a-E10K	IC50	1 nM	[30]
Toxin Info Pn3a-K24R	IC50	1 nM	[30]
Toxin Info AM-8145-1	IC50	1.1 nM	[29]
Toxin Info AM-8145-30	IC50	1.1 nM	[29]
Toxin Info AM-8145-31	IC50	1.1 nM	[29]
Toxin Info AM-8145-13	IC50	1.3 nM	[29]
Toxin Info AM-8145-38	IC50	1.3 nM	[29]
Toxin Info AM-8145-5	IC50	1.6 nM	[29]
Toxin Info E1A,E4A,des (S19,S20),Y33W	IC50	1.6 ± 0.3 nM	[31]
Toxin Info HwTx-IV (E4G)	IC50	1.6 ± 1.1 nM	[31]
Toxin Info AM-8145-2	IC50	1.7 nM	[29]
Toxin Info E1G,E4G,des (S19,S20),Y33W	IC50	1.7 ± 0.4 nM	[31]
Toxin Info [R26A]gHwTx-IV	IC50	1.7 ± 0.5 nM	[32]
Toxin Info GPTX1 (Phe5 Met)	IC50	2 nM	[33]
Toxin Info Pn3a-E13K	IC50	2 nM	[30]
Toxin Info HwTx-IV (E1G,E4G)	IC50	2.0 ± 1.1 nM	[31]
Toxin Info Mu-theraphotoxin-Tp1a	IC50	2.1 nM	[34]
Toxin Info AM-8145-36	IC50	2.5 nM	[29]
Toxin Info E1A,E4A	IC50	2.8 ± 1.3 nM	[31]
Toxin Info AM-8145-3	IC50	3 nM	[29]
Toxin Info AM-8145-25	IC50	3.1 nM	[29]
Toxin Info m3-HwTx-IV	IC50	3.3 ± 1.1 nM	[32]
Toxin Info HwTx-IV (E4K,R26Q)	IC50	3.6 ± 1.1 nM	[31]
Toxin Info PTx2-3258	IC50	3.8 nM	[35]
Toxin Info Pn3a	IC50	4 nM	[30]
Toxin Info Pn3a-D8G	IC50	4 nM	[30]
Toxin Info GPTX1 (Phe5 Leu)	IC50	5 nM	[33]
Toxin Info PTx2-3128	IC50	5 nM	[36]
Toxin Info rHwTx-IV (S25A)	IC50	5.1 ± 0.2 nM	[31]
Toxin Info Mu/omega-theraphotoxin-Pmu1a	IC50	5.5 - 7 nM	[37]
Toxin Info AM-8145-35	IC50	5.7 nM	[29]
Toxin Info rHwTx-IV (D14A)	IC50	5.9 ± 0.01 nM	[31]
Toxin Info E1A	IC50	6 ± 1 nM	[31]
Toxin Info rHwTx-IV (P11A)	IC50	6.0 ± 0.1 nM	[31]
Toxin Info rHwTx-IV (L22A)	IC50	6.1 ± 0.01 nM	[31]
Toxin Info rHwTx-IV (Y33A)	IC50	6.1 ± 0.03 nM	[31]
Toxin Info rHwTx-IV (I35A)	IC50	6.2 ± 0.06 nM	[31]
Toxin Info rHwTx-IV (F6A)	IC50	6.3 ± 0.04 nM	[31]
Toxin Info rHwTx-IV (G36A)	IC50	6.4 ± 0.02 nM	[31]
Toxin Info HwTx-IV (K18A)	IC50	6.4 ± 1.1 nM	[31]
Toxin Info rHwTx-IV (L3A)	IC50	6.6 ± 0.1 nM	[31]
Toxin Info rHwTx-IV (K27A)	IC50	6.7 ± 0.03 nM	[31]
Toxin Info AM-8145-19	IC50	6.8 nM	[29]
Toxin Info rHwTx-IV (K7A)	IC50	6.8 ± 0.08 nM	[31]
Toxin Info PTx2-3127	IC50	6.9 nM	[36]
Toxin Info rHwTx-IV (R26A)	IC50	6.9 ± 0.04 nM	[31]
Toxin Info rHwTx-IV (K21A)	IC50	6.9 ± 0.06 nM	[31]
Toxin Info rHwTx-IV (V23A)	IC50	6.9 ± 0.07 nM	[31]
Toxin Info HwTx-IV (E1G)	IC50	6.9 ± 1.1 nM	[31]
Toxin Info rHwTx-IV (S19A)	IC50	7.0 ± 0.05 nM	[31]
Toxin Info rHwTx-IV (N13A)	IC50	7.0 ± 0.1 nM	[31]
Toxin Info rHwTx-IV (K37A)	IC50	7.0 ± 0.10 nM	[31]
Toxin Info rHwTx-IV (S12A)	IC50	7.0 ± 0.13 nM	[31]
Toxin Info rHwTx-IV (N10A)	IC50	7.0 ± 0.14 nM	[31]
Toxin Info rHwTx-IV (Q34A)	IC50	7.1 ± 0.03 nM	[31]
Toxin Info rHwTx-IV (I5A)	IC50	7.1 ± 0.08 nM	[31]
Toxin Info rHwTx-IV (S20A)	IC50	7.2 ± 0.08 nM	[31]
Toxin Info rHwTx-IV (T28A)	IC50	7.2 ± 0.13 nM	[31]
Toxin Info rHwTx-IV (K18A)	IC50	7.3 ± 0.04 nM	[31]
Toxin Info rHwTx-IV (R29A)	IC50	7.3 ± 0.04 nM	[31]
Toxin Info rHwTx-IV (Q15A)	IC50	7.3 ± 0.13 nM	[31]
Toxin Info gHwTx-IV	IC50	7.6 ± 1.5 nM	[32]
Toxin Info [R29A]gHwTx-IV	IC50	7.7 ± 2.6 nM	[32]
Toxin Info PTx2-3361	IC50	8.6 nM	[35]
Toxin Info AM-8145-26	IC50	8.9 nM	[29]
Toxin Info GPTX1 (Phe5 Gly)	IC50	9 nM	[33]
Toxin Info GPTX1 (Phe5 Ile)	IC50	9 nM	[33]
Toxin Info des (S19,S20)	IC50	9 ± 2 nM	[31]
Toxin Info Huwentoxin-IV	IC50	9.6 - 33 nM	[31- 52]
Toxin Info HwTx-IV (E4K,CterCOOH)	IC50	11.9 ± 1.1 nM	[31]
Toxin Info Pn3a-E13A	IC50	12 nM	[30]
Toxin Info AM-8145-18	IC50	12.6 nM	[29]
Toxin Info HwTx-IV (E4K)	IC50	14.2 ± 1.2 nM	[31]
Toxin Info HwTx-IV (E4G,CterCOOH)	IC50	14.9 ± 1.1 nM	[31]
Toxin Info AM-8145-23	IC50	15 nM	[29]
Toxin Info Beta-theraphotoxin-Cd1a	IC50	16 nM	[53]
Toxin Info AM-6122	IC50	16.4 nM	[29]
Toxin Info HWTX-IV	IC50	17 nM	[31]
Toxin Info [R26A]gHwTx-IV	IC50	18.7 ± 4.3 nM	[32]
Toxin Info AM-8145-27	IC50	19 nM	[29]
Toxin Info GPTX1 (Phe5 Val)	IC50	19 nM	[33]
Toxin Info AM-8145-29	IC50	19.6 nM	[29]
Toxin Info PTx2-2	IC50	20 ± 2 nM	[54]
Toxin Info PTx2-3260	IC50	20.8 nM	[35]
Toxin Info AM-8145-11	IC50	22 nM	[29]
Toxin Info AM-8145-12	IC50	22 nM	[29]
Toxin Info HwTx-IV (Y33W)	IC50	22.2 ± 1.2 nM	[31]
Toxin Info AM-8145-28	IC50	24 nM	[29]
Toxin Info Pn3a-K22R	IC50	24 nM	[30]
Toxin Info Mu-scoloptoxin(03)-Ssm2a	IC50	25.4 nM	[33- 56]
Toxin Info E4A	IC50	26 ± 9 nM	[31]
Toxin Info GPTX1 (Phe5Ala)	IC50	27 nM	[57]
Toxin Info PTx2-3	IC50	27 ± 8 nM	[54]
Toxin Info HwTx-IV (K36,CterCOOH)	IC50	29.0 ± 1.2 nM	[31]
Toxin Info PTx2-17	IC50	30 ± 8 nM	[54]
Toxin Info PTx2-3066	IC50	30.8 nM	[35]
Toxin Info mHwTx-IV	IC50	30.8 ± 5.2 nM	[31]
Toxin Info AM-8145-20	IC50	32 nM	[29]
Toxin Info PTx2-1	IC50	32 ± 16 nM	[54]
Toxin Info PTx2-3259	IC50	41.8 nM	[36]
Toxin Info PTx2-5	IC50	42 ± 5 nM	[54]
Toxin Info PTx2-4	IC50	43 ± 10 nM	[54]
Toxin Info ProTX-11	IC50	44 ± 7 nM	[54]
Toxin Info PhlTx1-D7A	IC50	47.0 ± 40.9 nM	[58]
Toxin Info PTx2-3067	IC50	48.3 nM	[36]
Toxin Info GPTX1 (Ile10His)	IC50	50 nM	[57]
Toxin Info GPTX1 (Ile10Ser)	IC50	50 nM	[57]
Toxin Info PTx2-3064	IC50	52.6 nM	[35]
Toxin Info Mu-theraphotoxin-Os1a	IC50	52.7 - 129.5 nM	[59]
Toxin Info P[G5]K	IC50	58 nM	[60]
Toxin Info P[G6]K	IC50	61 nM	[60]
Toxin Info PTx2-6	IC50	63 ± 7 nM	[54]
Toxin Info PTx2-18	IC50	64 ± 12 nM	[54]
Toxin Info AM-8145-10	IC50	71 nM	[29]
Toxin Info PTx2-3065	IC50	73.9 nM	[35]
Toxin Info PTx2-7	IC50	74 ± 5 nM	[54]
Toxin Info PTx2-19	IC50	76 ± 23 nM	[54]
Toxin Info Pn3a-K24A	IC50	84 nM	[30]
Toxin Info PTx2-20	IC50	84 ± 16 nM	[54]
Toxin Info GPTX1 (Pro19Ala)	IC50	90 nM	[61]
Toxin Info GPTX1 (Ile10Glu)	IC50	90 nM	[57]
Toxin Info GPTX1 (Ile10Met)	IC50	90 nM	[57]
Toxin Info PTx2-8	IC50	91 ± 11 nM	[54]
Toxin Info PTx2-21	IC50	91 ± 24 nM	[54]
Toxin Info P[G7]K	IC50	94 nM	[60]
Toxin Info PTx2-9	IC50	97 ± 17 nM	[54]
Toxin Info PTx2-10	IC50	99 ± 11 nM	[54]
Toxin Info GPTX1 (Asp1Ala)	IC50	100 nM	[33]
Toxin Info GPTX1 (Ile10Thr)	IC50	100 nM	[57]
Toxin Info GPTX1 (Ile10Val)	IC50	100 nM	[57]
Toxin Info PTx2-22	IC50	109 ± 8 nM	[54]
Toxin Info GPTX1 (Ile10Phe)	IC50	110 nM	[57]
Toxin Info Mu-theraphotoxin-Hd1a	IC50	111 nM	[62]
Toxin Info HwTx-IV (R26A)	IC50	111.7 ± 1.2 nM	[31]
Toxin Info P[G8]K	IC50	112 nM	[60]
Toxin Info PTx2-11	IC50	113 ± 10 nM	[54]
Toxin Info HwTx-IV (T28W)	IC50	114.1 ± 1.2 nM	[31]
Toxin Info GPTX1 (Asp12Ala)	IC50	120 nM	[63]
Toxin Info GPTX1 (Arg18Ala)	IC50	130 nM	[64]
Toxin Info GPTX1 (Ile10Leu)	IC50	140 nM	[57]
Toxin Info GPTX1 (Ile10Tyr)	IC50	140 nM	[57]
Toxin Info HwTx-IV (R26Q)	IC50	141.4 ± 1.1 nM	[31]
Toxin Info P[G4]K	IC50	148 nM	[60]
Toxin Info [G2]KIIIA	IC50	154 nM	[60]
Toxin Info PTx2-3063	IC50	154 nM	[35]
Toxin Info [G4]KIIIA	IC50	169 nM	[60]
Toxin Info GPTX1 (Pro11Ala)	IC50	170 nM	[65]
Toxin Info GPTX1 (Val33Ala)	IC50	170 nM	[66]
Toxin Info PhlTx1-A1Z	IC50	171.5 ± 51.0 nM	[58]
Toxin Info HwTx-IV (CterCOOH)	IC50	176.3 ± 1.1 nM	[31]
Toxin Info PhlTx1-S8A	IC50	179.5 ± 118.4 nM	[58]
Toxin Info AM-8145-21	IC50	182 nM	[29]
Toxin Info PTx2-12	IC50	183 ± 34 nM	[54]
Toxin Info PTx2-2955	IC50	185 nM	[35]
Toxin Info [G3]KIIIA	IC50	190 nM	[60]
Toxin Info GPTX1 (Asn13Ala)	IC50	190 nM	[63]
Toxin Info GPTX1 (Leu21Ala)	IC50	190 nM	[67]
Toxin Info GPTX1 (Ile10 2-Pal)	IC50	190 nM	[57]
Toxin Info GPTX1 (Ile10Ala)	IC50	210 nM	[65]
Toxin Info PTx2-13	IC50	218 ± 12 nM	[54]
Toxin Info GPTX1 (Ile10Asp)	IC50	220 nM	[57]
Toxin Info PTx2-14	IC50	225 ± 32 nM	[54]
Toxin Info GPTX1 (Lys15Ala)	IC50	230 nM	[64]
Toxin Info PTx2-15	IC50	232 ± 22 nM	[54]
Toxin Info [G5]PaurTx3	IC50	239 nM	[60]
Toxin Info PTx2-23	IC50	240 ± 49 nM	[54]
Toxin Info PhlTx1-K12A	IC50	252.5 ± 13.6 nM	[58]
Toxin Info PTx2-16	IC50	253 ± 45 nM	[54]
Toxin Info Mu-theraphotoxin-Pspp1	IC50	254.3 ± 147.6 nM	[58]
Toxin Info GPTX1 (Thr26Ala)	IC50	260 nM	[68]
Toxin Info GPTX1 (Gly4Ala)	IC50	270 nM	[69]
Toxin Info GPTX1 (Ile10 4-CO2-F)	IC50	280 nM	[57]
Toxin Info PaurTx3	IC50	290 nM	[60]
Toxin Info GPTX1 (Arg25Ala)	IC50	330 nM	[70]
Toxin Info GPTX1 (Ile10Asn)	IC50	330 nM	[57]
Toxin Info Mu-theraphotoxin-Phlo2a	IC50	333 nM	[71]
Toxin Info P[G3]K	IC50	342 nM	[60]
Toxin Info Delta-theraphotoxin-Cg1a 2	IC50	348 nM	[72- 78]
Toxin Info Delta-theraphotoxin-Cg1a 3	IC50	348 nM	[72- 78]
Toxin Info Delta-theraphotoxin-Cg1a 1	IC50	348 nM	[73- 79]
Toxin Info PaurTX3[LPATGG]	IC50	359 nM	[60]
Toxin Info Mu-theraphotoxin-Phlo1b	IC50	360 nM	[71]
Toxin Info KIIIA	IC50	363 nM	[60]
Toxin Info [G5]KIIIA	IC50	369 nM	[60]
Toxin Info GPTX1 (N-Term. Ala)	IC50	370 nM	[33]
Toxin Info GPTX1 (Val22Ala)	IC50	380 nM	[67]
Toxin Info [G6]KIIIA	IC50	390 nM	[60]
Toxin Info GPTX1 (C-Term. -Ala)	IC50	410 nM	[80]
Toxin Info GPTX1 (Leu3Ala)	IC50	430 nM	[69]
Toxin Info GPTX1 (Met6Ala)	IC50	430 nM	[81]
Toxin Info Voltage sensor toxin 3	IC50	430 nM	[82]
Toxin Info Voltage sensor toxin 3	IC50	430 nM	[83]
Toxin Info Mu-theraphotoxin-Phlo1a	IC50	459 nM	[71]
Toxin Info GPTX1 (Lys28Ala)	IC50	470 nM	[84]
Toxin Info GPTX1 (Ser24Ala)	IC50	470 nM	[70]
Toxin Info AM-8145-16	IC50	471 nM	[29]
Toxin Info GPTX1 (Lys8Ala)	IC50	500 nM	[85]
Toxin Info AM-8145-17	IC50	540 nM	[29]
Toxin Info Mu-theraphotoxin-Cg1a	IC50	610 nM	[72- 87]
Toxin Info GPTX1 (Phe5Ala)	IC50	630 nM	[81]
Toxin Info P[G2]K	IC50	682 nM	[60]
Toxin Info GPTX1 (Asn20Ala)	IC50	690 nM	[61]
Toxin Info GPTX1 (Ile10His)	IC50	700 nM	[57]
Toxin Info PhlTx1-K15A	IC50	706.4 ± 87.8 nM	[58]
Toxin Info GPTX1 (Tyr32Ala)	IC50	800 nM	[88]
Toxin Info K[G5]PaurTx3	IC50	813 nM	[60]
Toxin Info AM-8145-15	IC50	825 nM	[29]
Toxin Info [G7]KIIIA	IC50	860 nM	[60]
Toxin Info [G8]KIIIA	IC50	920 nM	[60]
Toxin Info GPTX1 (Arg7-Ala)	IC50	940 nM	[85]
Toxin Info GPTX1 (His27Ala)	IC50	970 nM	[68]
Toxin Info PhlTx1-K25A	IC50	> 10 μM	[58]
Toxin Info PhlTx1-W24A	IC50	> 10 μM	[58]
Toxin Info PhlTx1-Y26A	IC50	> 10 μM	[58]
Toxin Info AM-8145-24	IC50	>1 μM	[29]
Toxin Info Pn3a-D12T	IC50	>1 μM	[30]
Toxin Info Pn3a-D14K	IC50	>1 μM	[30]
Toxin Info Pn3a-K22A	IC50	>1 μM	[30]
Toxin Info Pn3a-K24D	IC50	>1 μM	[30]
Toxin Info Pn3a-W30A	IC50	>1 μM	[30]
Toxin Info Pn3a-Y27A	IC50	>1 μM	[30]
Toxin Info Hhn2b (G7W,N24S,W29A)	IC50	>10 μM	[89]
Toxin Info Hhn2b (K4L)	IC50	>10 μM	[89]
Toxin Info Hhn2b (V32W)	IC50	>10 μM	[89]
Toxin Info HNTX-I	IC50	>10 μM	[90]
Toxin Info HNTXI (E1G)	IC50	>10 μM	[90]
Toxin Info HNTX-III (Gly4delete)	IC50	>10 μM	[91]
Toxin Info HNTX-III (His26Lys)	IC50	>10 μM	[91]
Toxin Info HNTX-III (Leu33Glu)	IC50	>10 μM	[91]
Toxin Info HNTX-III (Leu33Lys)	IC50	>10 μM	[91]
Toxin Info HNTX-III (Lys30Arg)	IC50	>10 μM	[91]
Toxin Info HNTXI (L32W)	IC50	>10 μM	[90]
Toxin Info Ca2a-T4	IC50	>100 μM	[92]
Toxin Info Ca2a-T5	IC50	>100 μM	[92]
Toxin Info Ca2a-T6	IC50	>100 μM	[92]
Toxin Info Ca2a-T7	IC50	>100 μM	[92]
Toxin Info Ca2a-T8	IC50	>100 μM	[92]
Toxin Info GPTX1 (Lys31Trp)	IC50	>4.9 μM	[57]
Toxin Info GPTX1 (Met6Arg)	IC50	>4.9 μM	[57]
Toxin Info GPTX1 (Tyr32Lys)	IC50	>4.9 μM	[57]
Toxin Info GPTX1 (His27Glu)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Lys31Ala)	IC50	>5 μM	[88]
Toxin Info GPTX1 (Lys31Glu)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Met6Lys)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Phe34Glu)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Phe34Lys)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Phe5Glu)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Ser24Glu)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Trp29Ala)	IC50	>5 μM	[84]
Toxin Info GPTX1 (Trp29Arg)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Trp29Glu)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Trp29Lys)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Tyr32Glu)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Ile10Asn)	IC50	>5 μM	[57]
Toxin Info GPTX1 (Ile10Asp)	IC50	>5 μM	[57]
Toxin Info Ca2a-U1S	IC50	>50 μM	[92]
Toxin Info K0G1-P18K-A21L-V	IC50	0.007 ± 0.001 μM	[91]
Toxin Info P18K-A21L-V	IC50	0.013 ± 0.002 μM	[91]
Toxin Info K0G1-N19L-A21L-V	IC50	0.017 ± 0.005 μM	[91]
Toxin Info K0L1-P18K-A21L-L	IC50	0.022 ± 0.003 μM	[91]
Toxin Info K0G1-A21L-V	IC50	0.027 ± 0.007 μM	[91]
Toxin Info GPTX1 (Leu3Arg)	IC50	0.03 ± 0 μM	[57]
Toxin Info GPTX1 (Met6Trp)	IC50	0.03 ± 0.02 μM	[57]
Toxin Info HNTXI (E1G,N23S,D26H,L32W)	IC50	0.036 ± 0.007 μM	[90]
Toxin Info GPTX1 (Thr26Arg)	IC50	0.04 ± 0.01 μM	[57]
Toxin Info GPTX1 (Thr26Lys)	IC50	0.04 ± 0.01 μM	[57]
Toxin Info K0G1-P18K-A21V	IC50	0.040 ± 0.006 μM	[91]
Toxin Info A21L-V	IC50	0.047 ± 0.016 μM	[91]
Toxin Info K0K1-N19L-A21L-L	IC50	0.048 ± 0.022 μM	[91]
Toxin Info GPTX1 (Gly4Trp)	IC50	0.05 ± 0.01 μM	[57]
Toxin Info GPTX1 (Val33Trp)	IC50	0.05 ± 0.01 μM	[57]
Toxin Info GPTX1 (C-Term. -Trp)	IC50	0.05 ± 0.02 μM	[57]
Toxin Info GPTX1 (Thr26Trp)	IC50	0.05 ± 0.02 μM	[57]
Toxin Info GPTX1 (Val33Lys)	IC50	0.05 ± 0.02 μM	[57]
Toxin Info HNTX-III (Pro18Lys)	IC50	0.050 ± 0.002 μM	[91]
Toxin Info GPTX1 (Asp12Trp)	IC50	0.06 ± 0.01 μM	[57]
Toxin Info GPTX1 (Val22Arg)	IC50	0.06 ± 0.01 μM	[57]
Toxin Info GPTX1 (Val22Trp)	IC50	0.06 ± 0.03 μM	[57]
Toxin Info GPTX1 (Asp1Trp)	IC50	0.07 ± 0.02 μM	[57]
Toxin Info GPTX1 (Pro19Arg)	IC50	0.07 ± 0.02 μM	[57]
Toxin Info GPTX1 (Asn20Trp)	IC50	0.07 ± 0.03 μM	[57]
Toxin Info HNTXI (N23S,D26H,L32W)	IC50	0.071 ± 0.005 μM	[90]
Toxin Info HNTX-III (Tyr32Trp)	IC50	0.075 ± 0.016 μM	[91]
Toxin Info HNTXI (N23S,D26H)	IC50	0.079 ± 0.004 μM	[90]
Toxin Info GPTX1 (Pro11Trp)	IC50	0.08 ± 0 μM	[57]
Toxin Info GPTX1 (Asn13Trp)	IC50	0.08 ± 0.01 μM	[57]
Toxin Info GPTX1 (Val33Arg)	IC50	0.08 ± 0.01 μM	[57]
Toxin Info HNTX-III (Lys0Gly1)	IC50	0.086 ± 0.012 μM	[91]
Toxin Info K0G1-P18K-A21L-L	IC50	0.087 ± 0.017 μM	[91]
Toxin Info GPTX-1	IC50	0.09 ± 0.01 μM	[57]
Toxin Info GPTX1 (Tyr32Trp)	IC50	0.09 ± 0.02 μM	[57]
Toxin Info GPTX1 (Lys28Arg)	IC50	0.09 ± 0.03 μM	[57]
Toxin Info GPTX1 (Ile10Glu)	IC50	0.09 ± 0.06 μM	[57]
Toxin Info HNTX-III (Asn19Leu)	IC50	0.092 ± 0.046 μM	[91]
Toxin Info HNTX-III (Ala21Val)	IC50	0.099 ± 0.019 μM	[91]
Toxin Info GPTX1 (Asp12Arg)	IC50	0.11 ± 0.01 μM	[57]
Toxin Info GPTX1 (Asp1Arg)	IC50	0.11 ± 0.03 μM	[57]
Toxin Info GPTX1 (Leu21Trp)	IC50	0.11 ± 0.03 μM	[57]
Toxin Info K0K1-P18K-A21L-L	IC50	0.112 ± 0.027 μM	[91]
Toxin Info GPTX1 (Asp12Lys)	IC50	0.12 ± 0.01 μM	[57]
Toxin Info GPTX1 (Pro19Lys)	IC50	0.12 ± 0.01 μM	[57]
Toxin Info GPTX1 (N-Term. Lys)	IC50	0.12 ± 0.01 μM	[57]
Toxin Info GPTX1 (Leu3Lys)	IC50	0.12 ± 0.05 μM	[57]
Toxin Info K0G1-N19L-A21L-L	IC50	0.121 ± 0.010 μM	[91]
Toxin Info HNTX-III (Pro11Lys)	IC50	0.127 ± 0.026 μM	[91]
Toxin Info GPTX1 (Ile10Trp)	IC50	0.13 ± 0 μM	[57]
Toxin Info GPTX1 (C-Term. -Arg)	IC50	0.13 ± 0.01 μM	[57]
Toxin Info GPTX1 (Lys8Arg)	IC50	0.13 ± 0.05 μM	[57]
Toxin Info HNTX-III (Ala21Leu)	IC50	0.133 ± 0.010 μM	[91]
Toxin Info GPTX1 (Asn13Arg)	IC50	0.14 ± 0.03 μM	[57]
Toxin Info HNTX-III (Lys0Leu1)	IC50	0.145 ± 0.049 μM	[91]
Toxin Info GPTX1 (Asp1Lys)	IC50	0.15 ± 0.02 μM	[57]
Toxin Info HNTX-III (Gly1Lys)	IC50	0.150 ± 0.024 μM	[91]
Toxin Info HNTX-III (Gly6Trp)	IC50	0.167 ± 0.017 μM	[91]
Toxin Info GPTX1 (Asn20Arg)	IC50	0.17 ± 0.01 μM	[57]
Toxin Info GPTX1 (N-Term. Arg)	IC50	0.17 ± 0.06 μM	[57]
Toxin Info GPTX1 (Ile10Arg)	IC50	0.17 ± 0.11 μM	[57]
Toxin Info HNTXI (E1G,N23S,D26H)	IC50	0.179 ± 0.024 μM	[90]
Toxin Info GPTX1 (Arg18Trp)	IC50	0.18 ± 0.04 μM	[57]
Toxin Info GPTX1 (N-Term. Trp)	IC50	0.20 ± 0.06 μM	[57]
Toxin Info GPTX1 (Phe5Trp)	IC50	0.20 ± 0.08 μM	[57]
Toxin Info GPTX1 (Val22Lys)	IC50	0.20 ± 0.12 μM	[57]
Toxin Info GPTX1 (Asn13Lys)	IC50	0.21 ± 0.01 μM	[57]
Toxin Info GPTX1 (Gly4Lys)	IC50	0.21 ± 0.04 μM	[57]
Toxin Info HNTX-III	IC50	0.211 ± 0.049 μM	[91]
Toxin Info HNTX-III (Leu33Phe)	IC50	0.215 ± 0.029 μM	[91]
Toxin Info GPTX1 (Arg18Glu)	IC50	0.22 ± 0.01 μM	[57]
Toxin Info GPTX1 (Asp1Glu)	IC50	0.22 ± 0.05 μM	[57]
Toxin Info GPTX1 (Pro11Glu)	IC50	0.22 ± 0.12 μM	[57]
Toxin Info GPTX1 (Lys15Arg)	IC50	0.22 ± 0.14 μM	[57]
Toxin Info HNTX-III (Pro18Trp)	IC50	0.225 ± 0.027 μM	[91]
Toxin Info GPTX1 (Ile10Lys)	IC50	0.23 ± 0.01 μM	[57]
Toxin Info GPTX1 (Gly4Arg)	IC50	0.23 ± 0.06 μM	[57]
Toxin Info HNTX-III (Pro18Leu)	IC50	0.255 ± 0.078 μM	[91]
Toxin Info GPTX1 (N-Term. Glu)	IC50	0.27 ± 0.03 μM	[57]
Toxin Info GPTX1 (Phe34Trp)	IC50	0.27 ± 0.04 μM	[57]
Toxin Info GPTX1 (Asn13Glu)	IC50	0.28 ± 0.03 μM	[57]
Toxin Info GPTX1 (Asp12Glu)	IC50	0.28 ± 0.05 μM	[57]
Toxin Info HNTX-III (Gly1Phe)	IC50	0.282 ± 0.056 μM	[91]
Toxin Info GPTX1 (His27Trp)	IC50	0.32 ± 0 μM	[57]
Toxin Info GPTX1 (Lys28Glu)	IC50	0.34 ± 0.08 μM	[57]
Toxin Info GPTX1 (Arg18Lys)	IC50	0.36 ± 0.09 μM	[57]
Toxin Info GPTX1 (Arg25Lys)	IC50	0.38 ± 0.23 μM	[57]
Toxin Info HNTX-III (Asn19Lys)	IC50	0.431 ± 0.058 μM	[91]
Toxin Info HNTXI (N23S)	IC50	0.435 ± 0.072 μM	[90]
Toxin Info Hhn2b (G7W,N24S)	IC50	0.44 ± 0.04 μM	[89]
Toxin Info GPTX1 (His27Arg)	IC50	0.45 ± 0.06 μM	[57]
Toxin Info HNTX-III (Phe0Gly1)	IC50	0.475 ± 0.091 μM	[91]
Toxin Info HNTX-III (Ala0Gly1)	IC50	0.486 ± 0.073 μM	[91]
Toxin Info Ca2a	IC50	0.487 μM	[92]
Toxin Info HNTX-III (Tyr20Trp)	IC50	0.495 ± 0.039 μM	[91]
Toxin Info HNTX-III (21Val)	IC50	0.512 ± 0.078 μM	[91]
Toxin Info K0G1-P18K-A21V-V	IC50	0.526 ± 0.048 μM	[91]
Toxin Info GPTX1 (Arg7-Lys)	IC50	0.54 ± 0.06 μM	[57]
Toxin Info GPTX1 (Val33Glu)	IC50	0.56 ± 0.08 μM	[57]
Toxin Info HNTX-III (Lys27Gln)	IC50	0.568 ± 0.042 μM	[91]
Toxin Info GPTX1 (Lys15Glu)	IC50	0.59 ± 0 μM	[57]
Toxin Info GPTX1 (C-Term. -Lys)	IC50	0.59 ± 0.04 μM	[57]
Toxin Info GPTX1 (Asn20Lys)	IC50	0.63 ± 0.16 μM	[57]
Toxin Info HNTX-III (Lys25Arg)	IC50	0.647 ± 0.046 μM	[91]
Toxin Info HNTXI (E1G,R25K,D26H,L32W)	IC50	0.669 ± 0.070 μM	[90]
Toxin Info GPTX1 (Leu3Glu)	IC50	0.67 ± 0.04 μM	[57]
Toxin Info GPTX1 (Thr26Glu)	IC50	0.69 ± 0.06 μM	[57]
Toxin Info GPTX1 (Arg25Glu)	IC50	0.72 ± 0.04 μM	[57]
Toxin Info HNTXI (E1G,R25K,D26H)	IC50	0.766 ± 0.029 μM	[90]
Toxin Info HNTX-III (Gly4Gln)	IC50	0.815 ± 0.031 μM	[91]
Toxin Info GPTX1 (Arg7-Glu)	IC50	0.86 ± 0.34 μM	[57]
Toxin Info HNTX-III (Pro11Glu)	IC50	0.927 ± 0.076 μM	[91]
Toxin Info GPTX1 (Lys31Arg)	IC50	0.95 ± 0.08 μM	[57]
Toxin Info O-MrVIB	IC50	1 μM	[93]
Toxin Info GPTX1 (Ile10Tyr)	IC50	1 μM	[57]
Toxin Info Pn3a-Y4A	IC50	1 μM	[30]
Toxin Info Hhn2b (G7W,N24S,W29F)	IC50	1.0 ± 0.2 μM	[89]
Toxin Info GPTX1 (Tyr32Arg)	IC50	1.03 ± 0.24 μM	[57]
Toxin Info GPTX1 (Ile10Phe)	IC50	1.1 μM	[57]
Toxin Info GPTX1 (Ile10Thr)	IC50	1.1 μM	[57]
Toxin Info GPTX1 (Phe34Ala)	IC50	1.2 μM	[66]
Toxin Info HNTX-III (Phe5Trp)	IC50	1.227 ± 0.167 μM	[91]
Toxin Info HNTX-III (S24N)	IC50	1.28 μM	[94]
Toxin Info GPTX1 (Ile10Val)	IC50	1.4 μM	[57]
Toxin Info GPTX1 (Asn20Glu)	IC50	1.40 ± 0 μM	[57]
Toxin Info GPTX1 (Val22Glu)	IC50	1.40 ± 0.57 μM	[57]
Toxin Info HNTXI (D26H)	IC50	1.498 ± 0.093 μM	[90]
Toxin Info GPTX1 (His27Lys)	IC50	1.5 ± 0.28 μM	[57]
Toxin Info HNTX-III (Thr10Glu)	IC50	1.657 ± 0.037 μM	[91]
Toxin Info GPTX1 (Lys8Glu)	IC50	1.70 ± 0.57 μM	[57]
Toxin Info GPTX1 (Gly4Glu)	IC50	1.75 ± 0.21 μM	[57]
Toxin Info HNTX-III (Gly12Glu)	IC50	1.891 ± 0.142 μM	[91]
Toxin Info GPTX1 (Ile10Ser)	IC50	2 μM	[57]
Toxin Info A23V PoTx	IC50	2.01 ± 0.102 μM	[95]
Toxin Info HNTX-III (Phe5Leu)	IC50	2.041 ± 0.015 μM	[91]
Toxin Info PTx2-3126	IC50	2.3 μM	[36]
Toxin Info GPTX1 (Phe34Arg)	IC50	2.35 ± 0.64 μM	[57]
Toxin Info GPTX1 (Ile10Leu)	IC50	2.5 μM	[57]
Toxin Info Hhn2b (G7W)	IC50	2.7 ± 0.4 μM	[89]
Toxin Info GPTX1 (Ile10 2-Pal)	IC50	2.9 μM	[57]
Toxin Info HNTX-III (Y20H,S24N)	IC50	2.99 μM	[94]
Toxin Info HNTX-III (Tyr32Leu)	IC50	3.076 ± 0.054 μM	[91]
Toxin Info GPTX1 (Ile10Met)	IC50	3.1 μM	[57]
Toxin Info Beta-theraphotoxin-Cd1a	IC50	3.34 μM	[53]
Toxin Info GPTX1 (Met6Glu)	IC50	3.50 ± 0.71 μM	[57]
Toxin Info GPTX1 (Phe5Arg)	IC50	3.60 ± 0.28 μM	[57]
Toxin Info PoTx	IC50	3.98 ± 0.352 μM	[95]
Toxin Info GPTX1 (Ile10 4-CO2-F)	IC50	4 μM	[57]
Toxin Info Hhn2b (N24S)	IC50	4 ± 0.5 μM	[89]
Toxin Info Ca2a-K27A	IC50	4.073 ± 0.5669 μM	[92]
Toxin Info GPTX1 (C-Term. -Glu)	IC50	4.45 ± 0.64 μM	[57]
Toxin Info GPTX1 (Ile10Glu)	IC50	4.5 μM	[57]
Toxin Info HwTx-IV (K32N)	IC50	5.752.0 ± 0.0016 μM	[31]
Toxin Info HNTX-III (His26Leu)	IC50	5.781 ± 0.117 μM	[91]
Toxin Info HNTX-III (H26D)	IC50	7.58 μM	[94]
Toxin Info HNTX-III (His26Asp)	IC50	7.58 ± 0.020 μM	[91]
Toxin Info A23E PoTx	IC50	7.78 ± 0.912 μM	[95]
Toxin Info Hhn2b (G7W,N24A)	IC50	8.6 ± 1.7 μM	[89]
Toxin Info Ca2a-T13	IC50	8.89 μM	[92]
Toxin Info HNTX-III (Y20H)	IC50	9.56 μM	[94]
Toxin Info Ca2a-T1	IC50	14.71 μM	[92]
Toxin Info Ca2a-T2	IC50	16.49 μM	[92]
Toxin Info Ca2a-T3	IC50	39.59 μM	[92]
Toxin Info Ca2a-T11	IC50	49.18 μM	[92]
Toxin Info Ca2a-T10	IC50	53.55 μM	[92]
Toxin Info Ca2a-T9	IC50	67.31 μM	[92]
Toxin Info Ca2a-K18A	IC50	683.3 ± 130.5 μM	[92]
Toxin Info rHwTx-IV (W30Y)	pIC50	5.7 ± 0.08 .	[96]
Toxin Info rHwTx-IV (K18F)	pIC50	6.5 ± 0.03 .	[96]
Toxin Info rHwTx-IV (D14P)	pIC50	6.6 ± 0.03 .	[96]
Toxin Info rHwTx-IV (R26G)	pIC50	6.6 ± 0.06 .	[96]
Toxin Info rHwTx-IV (N13G)	pIC50	6.8 ± 0.07 .	[96]
Toxin Info rHwTx-IV (R26K)	pIC50	6.8 ± 0.22 .	[96]
Toxin Info rHwTx-IV (W30K)	pIC50	6.9 ± 0.12 .	[96]
Toxin Info rHwTx-IV (G36I)	pIC50	7.0 ± 0.07 .	[96]
Toxin Info rHwTx-IV	pIC50	7.0 ± 0.14 .	[96]
Toxin Info rHwTx-IV (K27W)	pIC50	7.2 ± 0.06 .	[96]
Toxin Info rHwTx-IV (Y33T)	pIC50	7.2 ± 0.07 .	[96]
Toxin Info rHwTx-IV (S19Q)	pIC50	7.4 ± 0.22 .	[96]
Toxin Info rHwTx-IV (Q34L)	pIC50	7.5 ± 0.04 .	[96]
Toxin Info rHwTx-IV (S20N)	pIC50	7.5 ± 0.05 .	[96]
Toxin Info rHwTx-IV (Q34S)	pIC50	7.5 ± 0.07 .	[96]
Toxin Info rHwTx-IV (S19P)	pIC50	7.5 ± 0.09 .	[96]
Toxin Info rHwTx-IV (E4Q)	pIC50	7.5 ± 0.10 .	[96]
Toxin Info rHwTx-IV (E4N)	pIC50	7.6 ± 0.03 .	[96]
Toxin Info rHwTx-IV (E1N)	pIC50	7.6 ± 0.1 .	[96]
Toxin Info rHwTx-IV (A8R)	pIC50	7.7 ± 0.02 .	[96]
Toxin Info rHwTx-IV (K37R)	pIC50	7.7 ± 0.03 .	[96]
Toxin Info rHwTx-IV (S19N)	pIC50	7.7 ± 0.04 .	[96]
Toxin Info rHwTx-IV (S25I)	pIC50	7.7 ± 0.07 .	[96]
Toxin Info rHwTx-IV (Q34F)	pIC50	7.7 ± 0.18 .	[96]
Toxin Info rHwTx-IV (E4R)	pIC50	7.9 ± 0.06 .	[96]
Toxin Info rHwTx-IV (K21R)	pIC50	7.9 ± 0.13 .	[96]

References

Ref 1	Comprehensive EST analysis of the symbiotic sea anemone, Anemonia viridis. BMC Genomics. 2009 Jul 23;10:333. doi: 10.1186/1471-2164-10-333.
Ref 2	A Low Molecular Weight Protein from the Sea Anemone Anemonia viridis with an Anti-Angiogenic Activity. Mar Drugs. 2018 Apr 19;16(4):134. doi: 10.3390/md16040134.
Ref 3	The mining of toxin-like polypeptides from EST database by single residue distribution analysis. BMC Genomics. 2011 Jan 31;12:88. doi: 10.1186/1471-2164-12-88.
Ref 4	Development of a rational nomenclature for naming peptide and protein toxins from sea anemones. Toxicon. 2012 Sep 15;60(4):539-50. doi: 10.1016/j.toxicon.2012.05.020. Epub 2012 Jun 5.
Ref 5	Evidence of accelerated evolution and ectodermal-specific expression of presumptive BDS toxin cDNAs from Anemonia viridis. Mar Drugs. 2013 Oct 30;11(11):4213-31. doi: 10.3390/md11114213.
Ref 6	Sea anemone peptides with a specific blocking activity against the fast inactivating potassium channel Kv3.4. J Biol Chem. 1998 Mar 20;273(12):6744-9. doi: 10.1074/jbc.273.12.6744.
Ref 7	Modulation of Kv3 subfamily potassium currents by the sea anemone toxin BDS: significance for CNS and biophysical studies. J Neurosci. 2005 Sep 21;25(38):8735-45. doi: 10.1523/JNEUROSCI.2119-05.2005.
Ref 8	Modulation of neuronal sodium channels by the sea anemone peptide BDS-I. J Neurophysiol. 2012 Jun;107(11):3155-67. doi: 10.1152/jn.00785.2011. Epub 2012 Mar 21.
Ref 9	A proton nuclear magnetic resonance study of the antihypertensive and antiviral protein BDS-I from the sea anemone Anemonia sulcata: sequential and stereospecific resonance assignment and secondary structure. Biochemistry. 1989 Mar 7;28(5):2178-87. doi: 10.1021/bi00431a032.
Ref 10	Determination of the three-dimensional solution structure of the antihypertensive and antiviral protein BDS-I from the sea anemone Anemonia sulcata: a study using nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing. Biochemistry. 1989 Mar 7;28(5):2188-98. doi: 10.1021/bi00431a033.
Ref 11	Precursors of Androctonus australis scorpion neurotoxins. Structures of precursors, processing outcomes, and expression of a functional recombinant toxin II. J Biol Chem. 1989 Nov 15;264(32):19259-65.
Ref 12	The amino-acid sequence of neurotoxin II of Androctonus australis Hector. Eur J Biochem. 1972 Jul 24;28(3):381-8. doi: 10.1111/j.1432-1033.1972.tb01924.x.
Ref 13	Disulfide bonds of toxin II of the scorpion Androctonus australis Hector. Eur J Biochem. 1974 Sep 16;47(3):483-9. doi: 10.1111/j.1432-1033.1974.tb03716.x.
Ref 14	Characterization of Amm VIII from Androctonus mauretanicus mauretanicus: a new scorpion toxin that discriminates between neuronal and skeletal sodium channels. Biochem J. 2003 Nov 1;375(Pt 3):551-60. doi: 10.1042/BJ20030688.
Ref 15	Expression of the standard scorpion alpha-toxin AaH II and AaH II mutants leading to the identification of some key bioactive elements. Biochim Biophys Acta. 2005 May 25;1723(1-3):91-9. doi: 10.1016/j.bbagen.2005.01.008. Epub 2005 Jan 29.
Ref 16	The scorpion toxin Amm VIII induces pain hypersensitivity through gain-of-function of TTX-sensitive Na? channels. Pain. 2013 Aug;154(8):1204-15. doi: 10.1016/j.pain.2013.03.037. Epub 2013 Apr 6.
Ref 17	Orthorhombic crystals and three-dimensional structure of the potent toxin II from the scorpion Androctonus australis Hector. Proc Natl Acad Sci U S A. 1988 Oct;85(20):7443-7. doi: 10.1073/pnas.85.20.7443.
Ref 18	Crystal structure of toxin II from the scorpion Androctonus australis Hector refined at 1.3 A resolution. J Mol Biol. 1994 Apr 22;238(1):88-103. doi: 10.1006/jmbi.1994.1270.
Ref 19	Ab initio structure determination and refinement of a scorpion protein toxin. Acta Crystallogr D Biol Crystallogr. 1997 Sep 1;53(Pt 5):551-7. doi: 10.1107/S0907444997005386.
Ref 20	Molecular basis of the high insecticidal potency of scorpion alpha-toxins. J Biol Chem. 2004 Jul 23;279(30):31679-86. doi: 10.1074/jbc.M402048200. Epub 2004 May 8.
Ref 21	Expression and purification of recombinant alpha-toxin AnCra1 from the scorpion Androctonus crassicauda and its functional characterization on mammalian sodium channels. Mol Biol Rep. 2021 Sep;48(9):6303-6312. doi: 10.1007/s11033-021-06624-2. Epub 2021 Aug 11.
Ref 22	Peptide ion channel toxins from the bootlace worm, the longest animal on Earth. Sci Rep. 2018 Mar 22;8(1):4596. doi: 10.1038/s41598-018-22305-w.
Ref 23	Functional Characterization of the Nemertide Family of Peptide Toxins. J Nat Prod. 2021 Aug 27;84(8):2121-2128. doi: 10.1021/acs.jnatprod.1c00104. Epub 2021 Aug 16.
Ref 24	Purification, characterization, synthesis, and cloning of the lockjaw peptide from Conus purpurascens venom. Biochemistry. 1995 Apr 18;34(15):4913-8. doi: 10.1021/bi00015a002.
Ref 25	Strategy for rapid immobilization of prey by a fish-hunting marine snail. Nature. 1996 May 9;381(6578):148-51. doi: 10.1038/381148a0.
Ref 26	Distinction among neuronal subtypes of voltage-activated sodium channels by mu-conotoxin PIIIA. J Neurosci. 2000 Jan 1;20(1):76-80. doi: 10.1523/JNEUROSCI.20-01-00076.2000.
Ref 27	Delta-conotoxin structure/function through a cladistic analysis. Biochemistry. 2001 Nov 6;40(44):13201-8. doi: 10.1021/bi010683a.
Ref 28	Isolation, characterization and total regioselective synthesis of the novel O-conotoxin MfVIA from Conus magnificus that targets voltage-gated sodium channels. Biochem Pharmacol. 2012 Aug 15;84(4):540-8. doi: 10.1016/j.bcp.2012.05.008. Epub 2012 May 16.
Ref 29	Discovery of Tarantula Venom-Derived Na(V)1.7-Inhibitory JzTx-V Peptide 5-Br-Trp24 Analogue AM-6120 with Systemic Block of Histamine-Induced Pruritis. J Med Chem. 2018 Nov 8;61(21):9500-9512. doi: 10.1021/acs.jmedchem.8b00736. Epub 2018 Oct 22.
Ref 30	Mapping the Molecular Surface of the Analgesic Na(V)1.7-Selective Peptide Pn3a Reveals Residues Essential for Membrane and Channel Interactions. ACS Pharmacol Transl Sci. 2020 Feb 19;3(3):535-546. doi: 10.1021/acsptsci.0c00002. eCollection 2020 Jun 12.
Ref 31	Potency optimization of Huwentoxin-IV on hNav1.7: a neurotoxin TTX-S sodium-channel antagonist from the venom of the Chinese bird-eating spider Selenocosmia huwena. Peptides. 2013 Jun;44:40-6. doi: 10.1016/j.peptides.2013.03.011. Epub 2013 Mar 19.
Ref 32	Manipulation of a spider peptide toxin alters its affinity for lipid bilayers and potency and selectivity for voltage-gated sodium channel subtype 1.7. J Biol Chem. 2020 Apr 10;295(15):5067-5080. doi: 10.1074/jbc.RA119.012281. Epub 2020 Mar 5.
Ref 33	Engineering potent and selective analogues of GpTx-1, a tarantula venom peptide antagonist of the Na(V)1.7 sodium channel. J Med Chem. 2015 Mar 12;58(5):2299-314. doi: 10.1021/jm501765v. Epub 2015 Feb 19.
Ref 34	Identification and Characterization of ProTx-III [-TRTX-Tp1a], a New Voltage-Gated Sodium Channel Inhibitor from Venom of the Tarantula Thrixopelma pruriens. Mol Pharmacol. 2015 Aug;88(2):291-303. doi: 10.1124/mol.115.098178. Epub 2015 May 15.
Ref 35	The alchemy of culture: intoxicants in society. BMJ. 1998 Nov 28;317(7171):1532B. doi: 10.1136/bmj.317.7171.1532b.
Ref 36	Computational design of peptides to target Na(V)1.7 channel with high potency and selectivity for the treatment of pain. Elife. 2022 Dec 28;11:e81727. doi: 10.7554/eLife.81727.
Ref 37	Pmu1a, a novel spider toxin with dual inhibitory activity at pain targets hNa(V) 1.7 and hCa(V) 3 voltage-gated channels. FEBS J. 2023 Jul;290(14):3688-3702. doi: 10.1111/febs.16773. Epub 2023 Mar 23.
Ref 38	cDNA sequence analysis of seven peptide toxins from the spider Selenocosmia huwena. Toxicon. 2003 Dec;42(7):715-23. doi: 10.1016/j.toxicon.2003.08.007.
Ref 39	Molecular diversification based on analysis of expressed sequence tags from the venom glands of the Chinese bird spider Ornithoctonus huwena. Toxicon. 2008 Jun 15;51(8):1479-89. doi: 10.1016/j.toxicon.2008.03.024. Epub 2008 Mar 27.
Ref 40	Function and solution structure of huwentoxin-IV, a potent neuronal tetrodotoxin (TTX)-sensitive sodium channel antagonist from Chinese bird spider Selenocosmia huwena. J Biol Chem. 2002 Dec 6;277(49):47564-71. doi: 10.1074/jbc.M204063200. Epub 2002 Sep 11.
Ref 41	Native pyroglutamation of huwentoxin-IV: a post-translational modification that increases the trapping ability to the sodium channel. PLoS One. 2013 Jun 24;8(6):e65984. doi: 10.1371/journal.pone.0065984. Print 2013.
Ref 42	Tarantula huwentoxin-IV inhibits neuronal sodium channels by binding to receptor site 4 and trapping the domain ii voltage sensor in the closed configuration. J Biol Chem. 2008 Oct 3;283(40):27300-13. doi: 10.1074/jbc.M708447200. Epub 2008 Jul 14.
Ref 43	Synthesis and characterization of huwentoxin-IV, a neurotoxin inhibiting central neuronal sodium channels. Toxicon. 2008 Feb;51(2):230-9. doi: 10.1016/j.toxicon.2007.09.008. Epub 2007 Sep 29.
Ref 44	The tarantula toxins ProTx-II and huwentoxin-IV differentially interact with human Nav1.7 voltage sensors to inhibit channel activation and inactivation. Mol Pharmacol. 2010 Dec;78(6):1124-34. doi: 10.1124/mol.110.066332. Epub 2010 Sep 20.
Ref 45	Common molecular determinants of tarantula huwentoxin-IV inhibition of Na+ channel voltage sensors in domains II and IV. J Biol Chem. 2011 Aug 5;286(31):27301-10. doi: 10.1074/jbc.M111.246876. Epub 2011 Jun 9.
Ref 46	Gating modifier toxins isolated from spider venom: Modulation of voltage-gated sodium channels and the role of lipid membranes. J Biol Chem. 2018 Jun 8;293(23):9041-9052. doi: 10.1074/jbc.RA118.002553. Epub 2018 Apr 27.
Ref 47	Screening, large-scale production and structure-based classification of cystine-dense peptides. Nat Struct Mol Biol. 2018 Mar;25(3):270-278. doi: 10.1038/s41594-018-0033-9. Epub 2018 Feb 26.
Ref 48	Chemical Synthesis, Proper Folding, Na(v) Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. doi: 10.3390/toxins11060367.
Ref 49	Analysis of the structural and molecular basis of voltage-sensitive sodium channel inhibition by the spider toxin huwentoxin-IV (-TRTX-Hh2a). J Biol Chem. 2013 Aug 2;288(31):22707-20. doi: 10.1074/jbc.M113.461392. Epub 2013 Jun 12.
Ref 50	Spider peptide toxin HwTx-IV engineered to bind to lipid membranes has an increased inhibitory potency at human voltage-gated sodium channel hNa(V)1.7. Biochim Biophys Acta Biomembr. 2017 May;1859(5):835-844. doi: 10.1016/j.bbamem.2017.01.020. Epub 2017 Jan 20.
Ref 51	The structure, dynamics and selectivity profile of a NaV1.7 potency-optimised huwentoxin-IV variant. PLoS One. 2017 Mar 16;12(3):e0173551. doi: 10.1371/journal.pone.0173551. eCollection 2017.
Ref 52	Structures of human Na(v)1.7 channel in complex with auxiliary subunits and animal toxins. Science. 2019 Mar 22;363(6433):1303-1308. doi: 10.1126/science.aaw2493. Epub 2019 Feb 14.
Ref 53	Discovery and mode of action of a novel analgesic -toxin from the African spider Ceratogyrus darlingi. PLoS One. 2017 Sep 7;12(9):e0182848. doi: 10.1371/journal.pone.0182848. eCollection 2017.
Ref 54	Development of ProTx-II Analogues as Highly Selective Peptide Blockers of Na(v)1.7 for the Treatment of Pain. J Med Chem. 2022 Jan 13;65(1):485-496. doi: 10.1021/acs.jmedchem.1c01570. Epub 2021 Dec 21.
Ref 55	Discovery of a selective NaV1.7 inhibitor from centipede venom with analgesic efficacy exceeding morphine in rodent pain models. Proc Natl Acad Sci U S A. 2013 Oct 22;110(43):17534-9. doi: 10.1073/pnas.1306285110. Epub 2013 Sep 30.
Ref 56	Weaponization of a Hormone: Convergent Recruitment of Hyperglycemic Hormone into the Venom of Arthropod Predators. Structure. 2015 Jul 7;23(7):1283-92. doi: 10.1016/j.str.2015.05.003. Epub 2015 Jun 11.
Ref 57	Single Residue Substitutions That Confer Voltage-Gated Sodium Ion Channel Subtype Selectivity in the NaV1.7 Inhibitory Peptide GpTx-1. J Med Chem. 2016 Mar 24;59(6):2704-17. doi: 10.1021/acs.jmedchem.5b01947. Epub 2016 Mar 10.
Ref 58	Evaluation of the Spider (Phlogiellus genus) Phlotoxin 1 and Synthetic Variants as Antinociceptive Drug Candidates. Toxins (Basel). 2019 Aug 22;11(9):484. doi: 10.3390/toxins11090484.
Ref 59	From identification to functional characterization of cyriotoxin-1a, an antinociceptive toxin from the spider Cyriopagopus schioedtei. Br J Pharmacol. 2019 May;176(9):1298-1314. doi: 10.1111/bph.14628. Epub 2019 Apr 9.
Ref 60	Enzymatic Ligation of a Pore Blocker Toxin and a Gating Modifier Toxin: Creating Double-Knotted Peptides with Improved Sodium Channel Na(V)1.7 Inhibition. Bioconjug Chem. 2020 Jan 15;31(1):64-73. doi: 10.1021/acs.bioconjchem.9b00744. Epub 2019 Dec 16.
Ref 61	Application of ultra-performance liquid chromatography coupled with quadrupole time-of-flight mass spectrometry to identify curcumin metabolites produced by human intestinal bacteria. J Chromatogr B Analyt Technol Biomed Life Sci. 2015 Mar 15;985:38-47. doi: 10.1016/j.jchromb.2015.01.014. Epub 2015 Jan 24.
Ref 62	Seven novel modulators of the analgesic target NaV 1.7 uncovered using a high-throughput venom-based discovery approach. Br J Pharmacol. 2015 May;172(10):2445-58. doi: 10.1111/bph.13081. Epub 2015 Mar 4.
Ref 63	Evaluation of Diverse Community Asthma Interventions: Balancing Health Outcomes with Developing Community Capacity for Evidence-Based Program Measurement. Popul Health Manag. 2015 Oct;18(5):342-50. doi: 10.1089/pop.2014.0144. Epub 2015 Feb 6.
Ref 64	Changes to collagen structure during leather processing. J Agric Food Chem. 2015 Mar 11;63(9):2499-505. doi: 10.1021/jf506357j. Epub 2015 Feb 25.
Ref 65	Quantitative analysis of thiolated ligand exchange on gold nanoparticles monitored by 1H NMR spectroscopy. Anal Chem. 2015 Mar 3;87(5):2771-8. doi: 10.1021/ac504081k. Epub 2015 Feb 6.
Ref 66	Utilization of blood cultures in Danish hospitals: a population-based descriptive analysis. Clin Microbiol Infect. 2015 Apr;21(4):344.e13-21. doi: 10.1016/j.cmi.2014.11.018. Epub 2014 Nov 23.
Ref 67	High-performance liquid chromatography method for ferric iron chelators using a post-column reaction with Calcein Blue. J Chromatogr B Analyt Technol Biomed Life Sci. 2015 Mar 15;985:48-53. doi: 10.1016/j.jchromb.2015.01.027. Epub 2015 Jan 24.
Ref 68	Mango polyphenols and its protective effects on diseases associated to oxidative stress. Curr Pharm Biotechnol. 2015;16(3):272-80. doi: 10.2174/138920101603150202143532.
Ref 69	Video comment on Geoffroy Vanbiervliet et al., pages 871-877. Endoscopy. 2014 Oct;46(10):v4. doi: 10.1055/s-0034-1391663. Epub 2015 Feb 6.
Ref 70	Therapies targeting oxidative stress for human diseases: where are we now?. Curr Pharm Biotechnol. 2015;16(3):195. doi: 10.2174/156802661503150202123740.
Ref 71	Three Peptide Modulators of the Human Voltage-Gated Sodium Channel 1.7, an Important Analgesic Target, from the Venom of an Australian Tarantula. Toxins (Basel). 2015 Jun 30;7(7):2494-513. doi: 10.3390/toxins7072494.
Ref 72	Molecular diversity and evolution of cystine knot toxins of the tarantula Chilobrachys jingzhao. Cell Mol Life Sci. 2008 Aug;65(15):2431-44. doi: 10.1007/s00018-008-8135-x.
Ref 73	Proteomic and peptidomic analysis of the venom from Chinese tarantula Chilobrachys jingzhao. Proteomics. 2007 Jun;7(11):1892-907. doi: 10.1002/pmic.200600785.
Ref 74	Effects and mechanism of Chinese tarantula toxins on the Kv2.1 potassium channels. Biochem Biophys Res Commun. 2007 Jan 19;352(3):799-804. doi: 10.1016/j.bbrc.2006.11.086. Epub 2006 Nov 27.
Ref 75	Characterization of the excitatory mechanism induced by Jingzhaotoxin-I inhibiting sodium channel inactivation. Toxicon. 2007 Sep 15;50(4):507-17. doi: 10.1016/j.toxicon.2007.04.018. Epub 2007 May 3.
Ref 76	Molecular determinants for the tarantula toxin jingzhaotoxin-I interacting with potassium channel Kv2.1. Toxicon. 2013 Mar 1;63:129-36. doi: 10.1016/j.toxicon.2012.12.001. Epub 2012 Dec 13.
Ref 77	Molecular determinant for the tarantula toxin Jingzhaotoxin-I slowing the fast inactivation of voltage-gated sodium channels. Toxicon. 2016 Mar 1;111:13-21. doi: 10.1016/j.toxicon.2015.12.009. Epub 2015 Dec 23.
Ref 78	Sequence-specific assignment of 1H-NMR resonance and determination of the secondary structure of Jingzhaotoxin-I. Acta Biochim Biophys Sin (Shanghai). 2005 Aug;37(8):567-72. doi: 10.1111/j.1745-7270.2005.00078.x.
Ref 79	Jingzhaotoxin-I, a novel spider neurotoxin preferentially inhibiting cardiac sodium channel inactivation. J Biol Chem. 2005 Apr 1;280(13):12069-76. doi: 10.1074/jbc.M411651200. Epub 2004 Nov 17.
Ref 80	Subcutaneously administered antibiotics: a national survey of current practice from the French Infectious Diseases (SPILF) and Geriatric Medicine (SFGG) society networks. Clin Microbiol Infect. 2015 Apr;21(4):370.e1-3. doi: 10.1016/j.cmi.2014.11.017. Epub 2014 Nov 23.
Ref 81	The anti-cancer potency and mechanism of a novel tumor-activated fused toxin, DLM. Toxins (Basel). 2015 Feb 4;7(2):423-38. doi: 10.3390/toxins7020423.
Ref 82	Two tarantula venom peptides as potent and differential Na(V) channels blockers. Toxicon. 2014 Jan;77:58-67. doi: 10.1016/j.toxicon.2013.10.029. Epub 2013 Nov 7.
Ref 83	Localization of the voltage-sensor toxin receptor on KvAP. Biochemistry. 2004 Aug 10;43(31):10071-9. doi: 10.1021/bi049463y.
Ref 84	In situ cobalt-cobalt oxide/N-doped carbon hybrids as superior bifunctional electrocatalysts for hydrogen and oxygen evolution. J Am Chem Soc. 2015 Feb 25;137(7):2688-94. doi: 10.1021/ja5127165. Epub 2015 Feb 17.
Ref 85	Metabolomics of the bio-degradation process of aflatoxin B1 by actinomycetes at an initial pH of 6.0. Toxins (Basel). 2015 Feb 4;7(2):439-56. doi: 10.3390/toxins7020439.
Ref 86	Expression and characterization of jingzhaotoxin-34, a novel neurotoxin from the venom of the tarantula Chilobrachys jingzhao. Peptides. 2009 Jun;30(6):1042-8. doi: 10.1016/j.peptides.2009.02.018. Epub 2009 Mar 13.
Ref 87	Selective Closed-State Nav1.7 Blocker JZTX-34 Exhibits Analgesic Effects against Pain. Toxins (Basel). 2018 Feb 2;10(2):64. doi: 10.3390/toxins10020064.
Ref 88	Blood culture series benefit may be limited to selected clinical conditions: time to reassess. Clin Microbiol Infect. 2015 Apr;21(4):332-6. doi: 10.1016/j.cmi.2014.11.019. Epub 2014 Nov 27.
Ref 89	Rational Engineering Defines a Molecular Switch That Is Essential for Activity of Spider-Venom Peptides against the Analgesics Target NaV1.7. Mol Pharmacol. 2015 Dec;88(6):1002-10. doi: 10.1124/mol.115.100784. Epub 2015 Oct 1.
Ref 90	Engineering Gain-of-Function Analogues of the Spider Venom Peptide HNTX-I, A Potent Blocker of the hNa(V)1.7 Sodium Channel. Toxins (Basel). 2018 Sep 4;10(9):358. doi: 10.3390/toxins10090358.
Ref 91	Engineering of highly potent and selective HNTX-III mutant against hNa(v)1.7 sodium channel for treatment of pain. J Biol Chem. 2021 Jan-Jun;296:100326. doi: 10.1016/j.jbc.2021.100326. Epub 2021 Jan 23.
Ref 92	General mechanism of spider toxin family I acting on sodium channel Nav1.7. Zool Res. 2022 Sep 18;43(5):886-896. doi: 10.24272/j.issn.2095-8137.2022.185.
Ref 93	muO-conotoxin MrVIB selectively blocks Nav1.8 sensory neuron specific sodium channels and chronic pain behavior without motor deficits. Proc Natl Acad Sci U S A. 2006 Nov 7;103(45):17030-5. doi: 10.1073/pnas.0601819103. Epub 2006 Oct 31.
Ref 94	Natural mutations change the affinity of -theraphotoxin-Hhn2a to voltage-gated sodium channels. Toxicon. 2015 Jan;93:24-30. doi: 10.1016/j.toxicon.2014.11.220. Epub 2014 Nov 6.
Ref 95	A reexamination of poneratoxin from the venom of the bullet ant Paraponera clavata. Peptides. 2017 Dec;98:51-62. doi: 10.1016/j.peptides.2016.05.012. Epub 2016 Jun 3.
Ref 96	Comprehensive engineering of the tarantula venom peptide huwentoxin-IV to inhibit the human voltage-gated sodium channel hNa(v)1.7. J Biol Chem. 2020 Jan 31;295(5):1315-1327. doi: 10.1074/jbc.RA119.011318. Epub 2019 Dec 23.

Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

Report Data Error Suggest Improvement

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.

Target Information

Citation & Updates

Correspondence

DB Version: 2026-04

Update Cycle: 3-4 months

Data License: CC BY 4.0

Prof. Tingjun HOU ([tingjunhou@zju.edu.cn](mailto:tingjunhou@zju.edu.cn))

Prof. Zhonghua LIU ([liuzh@hunnu.edu.cn](mailto:liuzh@hunnu.edu.cn))

Prof. Xi ZHOU ([xizh@hunnu.edu.cn](mailto:xizh@hunnu.edu.cn))