General Information of This Peptide
Peptide ID
BTDP002060
Peptide Name
Delta-theraphotoxin-Cg1a 3
Symonym
Jingzhaotoxin-1.3; Jingzhaotoxin-I.3; Peptide F5-24.92
Species
Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)
Uniprot Name
JZT1C_CHIGU
Alphafold ID
B1P1B8
3D Structure
Download
2D Sequence
3D Structure
Source
Alphafold db: B1P1B8
Sequence
MKTSILFVIFSLALVFALSPATEIEETDRACGQFWWKCGEGKPPCCANFACKIGLYLCIW
SP
   Click to Show/Hide
Sequence Length
62
Mass (Da)
6906
Signal Sequence
MKTSILFVIFSLALVFA
   Click to Show/Hide
Sequence Removed Signal Peptide
LSPATEIEETDRACGQFWWKCGEGKPPCCANFACKIGLYLCIWSP
   Click to Show/Hide
Disulfide Bond
31-46;38-51;45-58
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Arthropoda
Class: Arachnida
Order: Araneae
Family: Theraphosidae
Genus: Chilobrachys
Species: Chilobrachys guangxiensis
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Nav1.5 IC50
335 nM
.
Voltage sensor-trapping mechanism
[1- 7]
 Target Info    Nav1.4 IC50
339 nM
.
Voltage sensor-trapping mechanism
[1- 7]
 Target Info    Nav1.7 IC50
348 nM
.
Voltage sensor-trapping mechanism
[1- 7]
 Target Info    Nav1.3 IC50
845 nM
.
Voltage sensor-trapping mechanism
[1- 7]
 Target Info    Nav1.2 IC50
870 nM
.
Voltage sensor-trapping mechanism
[1- 7]
 Target Info    potassium channels IC50
8.05 μM
.
Voltage sensor-trapping mechanism
[1- 7]
References
Ref 1 Molecular diversity and evolution of cystine knot toxins of the tarantula Chilobrachys jingzhao. Cell Mol Life Sci. 2008 Aug;65(15):2431-44. doi: 10.1007/s00018-008-8135-x.
Ref 2 Proteomic and peptidomic analysis of the venom from Chinese tarantula Chilobrachys jingzhao. Proteomics. 2007 Jun;7(11):1892-907. doi: 10.1002/pmic.200600785.
Ref 3 Effects and mechanism of Chinese tarantula toxins on the Kv2.1 potassium channels. Biochem Biophys Res Commun. 2007 Jan 19;352(3):799-804. doi: 10.1016/j.bbrc.2006.11.086. Epub 2006 Nov 27.
Ref 4 Characterization of the excitatory mechanism induced by Jingzhaotoxin-I inhibiting sodium channel inactivation. Toxicon. 2007 Sep 15;50(4):507-17. doi: 10.1016/j.toxicon.2007.04.018. Epub 2007 May 3.
Ref 5 Molecular determinants for the tarantula toxin jingzhaotoxin-I interacting with potassium channel Kv2.1. Toxicon. 2013 Mar 1;63:129-36. doi: 10.1016/j.toxicon.2012.12.001. Epub 2012 Dec 13.
Ref 6 Molecular determinant for the tarantula toxin Jingzhaotoxin-I slowing the fast inactivation of voltage-gated sodium channels. Toxicon. 2016 Mar 1;111:13-21. doi: 10.1016/j.toxicon.2015.12.009. Epub 2015 Dec 23.
Ref 7 Sequence-specific assignment of 1H-NMR resonance and determination of the secondary structure of Jingzhaotoxin-I. Acta Biochim Biophys Sin (Shanghai). 2005 Aug;37(8):567-72. doi: 10.1111/j.1745-7270.2005.00078.x.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.