Target Information
General Information of This Target
| Target ID |
BTDT00061
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Potassium voltage-gated channel subfamily A member 6 (Kcna6)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
Kcna6
|
|||||
| Synonym |
RCK2; Voltage-gated potassium channel subunit Kv1.6; Voltage-gated potassium channel subunit Kv2
|
|||||
| Sequence |
MRSEKSLTLAAPGEVRGPEGEQQDAGEFQEAEGGGGCCSSERLVINISGLRYETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFMEE IRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS VLVILISIVIFCLETLPQFRADGRGGSNEGSGTRMSPASRGSHEEEDEDEDSYAFPGSIP SGGLGTGGTSSFSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKAAFFRNIMNII DLVAIFPYFITLGTELVQRHEQQPVSGGSGQNRQQAMSLAILRVIRLVRVFRIFKLSRHS KGLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDVDSLFPSIPDAFWWAVVT MTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTH VTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV Click to Show/Hide
|
|||||
| Family |
the potassium channel family
|
|||||
| Function |
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium- selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KNCA5, KCNA6, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation (Probable). Homotetrameric channels display rapid activation and slow inactivation.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Kunitz-type serine protease inhibitor homolog delta-dendrotoxin | Dissociation constant |
23 nM
|
[1], [2] |
| Toxin Info Potassium channel toxin alpha-KTx 3.2 | Inhibition constant |
0.037 nM
|
[3- 7] |
| Toxin Info Potassium channel toxin alpha-KTx 1.1 | Inhibition constant |
22 nM
|
[3- 23] |
| Toxin Info Potassium channel toxin alpha-KTx 3.4 | Inhibition constant |
149 nM
|
[3- 24] |
| Toxin Info N.vectensis toxin 4 | Effect | . | [25] |
| Toxin Info N.vectensis toxin 5 | Effect | . | [25] |
| Toxin Info Mu-conotoxin CnIIIC | Inhibition rate | . | [26], [27], [28] |
| Toxin Info Crotamine | Inhibition rate | . | [29] |
| Toxin Info Toxin PhcrTx2 | Inhibition rate | . | [30] |
| Toxin Info Kunitz-type serine protease inhibitor homolog dendrotoxin K | Inhibition rate | . | [31] |
| Toxin Info Potassium channel toxin alpha-KTx 8.2 | Inhibition rate | . | [32] |
| Toxin Info Potassium channel toxin alpha-KTx 8.6 | Inhibition rate | . | [32], [33] |
| Toxin Info Potassium channel toxin alpha-KTx 8.6 | Inhibition rate | . | [32] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.1 | Inhibition rate | . | [34] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.2 | Inhibition rate | . | [34] |
| Toxin Info Apamin | Inhibition rate | . | [35- 52] |
| Toxin Info Potassium channel toxin alpha-KTx 3.11 | Inhibition rate | . | [53] |
| Toxin Info Mu-theraphotoxin-Pspp1 | Inhibition rate | . | [54] |
| Toxin Info Potassium channel toxin kappa-KTx 2.5 | Inhibition rate | . | [55] |
| Toxin Info Potassium channel toxin TsTXK-beta | Inhibition rate | . | [56] |
| Toxin Info Potassium channel toxin alpha-KTx 16.4 | Inhibition rate | . | [57] |
| Toxin Info KappaPI-actitoxin-Ael3a | Inhibition rate | . | [58], [59] |
| Toxin Info Kappa-hefutoxin 2 (C1A,Y2C,R3Y,N4R,C5N,W6C,R7W,E8R,G9E,N10G,D11N,E12D,T14E,C15T,K16C,E17K,R18E,C19R) | Inhibition rate |
8.8 %
|
[60] |
| Toxin Info Kappa-hefutoxin 2 (C1H,Y2A,R3C,N4Y,C5R,W6N,R7C,E8W,G9R,N10E,D11G,E12N,E13D,T14E,C15E,K16T,E17C,R18K,C19E) | Inhibition rate |
13.6 %
|
[60] |
| Toxin Info U-actitoxin-Avd3n | Inhibition rate |
14 %
|
[61] |
| Toxin Info Kunitz-type proteinase inhibitor AEPI-I | Inhibition rate |
18.7 %
|
[60] |
| Toxin Info Potassium channel toxin alpha-KTx 12.2 | Inhibition rate |
20 %
|
[62] |
| Toxin Info Potassium channel toxin alpha-KTx 12.1 | Inhibition rate |
20 %
|
[62] |
| Toxin Info Potassium channel toxin alpha-KTx 21.1 | Inhibition rate |
20 %
|
[63] |
| Toxin Info Potassium channel toxin alpha-KTx 31.1 | Inhibition rate |
21 %
|
[64] |
| Toxin Info Potassium channel toxin alpha-KTx 31.1 | Inhibition rate |
21 %
|
[64] |
| Toxin Info Potassium channel toxin alpha-KTx 21.1 | Inhibition rate |
22 %
|
[63- 68] |
| Toxin Info Kunitz-type serine protease inhibitor homolog dendrotoxin I | Inhibition rate |
26 %
|
[31] |
| Toxin Info Pi-stichotoxin-Hcr5b | Inhibition rate |
32 %
|
[69] |
| Toxin Info Potassium channel toxin kappa-KTx 5.1 | Inhibition rate |
59.8 %
|
[70] |
| Toxin Info Potassium channel toxin alpha-KTx 3.6 | Inhibition rate |
91 %
|
[71] |
| Toxin Info Potassium channel toxin alpha-KTx 3.13 | Inhibition rate |
93 %
|
[71] |
| Toxin Info Potassium channel toxin alpha-KTx 4.1 | Inhibition rate |
94 %
|
[62] |
| Toxin Info AgTx2 (K27M) | IC50 |
1.3 nM
|
[72] |
| Toxin Info Kappa-actitoxin-Bcs3a | IC50 |
1.31 nM
|
[73] |
| Toxin Info Kappa-actitoxin-Bcs3a | IC50 |
1.31 nM
|
[73] |
| Toxin Info Kappa-actitoxin-Bcs3b | IC50 |
7.76 nM
|
[73] |
| Toxin Info Kappa-actitoxin-Bcs3b | IC50 |
7.76 nM
|
[73] |
| Toxin Info Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | IC50 |
9 nM
|
[1- 76] |
| Toxin Info MeuKTx (G11R,G30R,D33H) | IC50 |
16.3 nM
|
[77- 96] |
| Toxin Info PI-stichotoxin-Hcr2g | IC50 |
43.9 nM
|
[97] |
| Toxin Info PI-stichotoxin-Hcr2g | IC50 |
43.9 nM
|
[98], [97], [99] |
| Toxin Info Potassium channel toxin alpha-KTx 3.19 | IC50 |
63.4 nM
|
[100] |
| Toxin Info Potassium channel toxin alpha-KTx 3.7 | IC50 |
71 nM
|
[6- 103] |
| Toxin Info Potassium channel toxin alpha-KTx 19.2 | IC50 |
75.9 nM
|
[104] |
| Toxin Info Potassium channel toxin alpha-KTx 19.2 | IC50 |
75.9 nM
|
[104] |
| Toxin Info Potassium channel toxin alpha-KTx 3.2 | IC50 |
92 nM
|
[3- 7] |
| Toxin Info Potassium channel toxin AbeTx1 | IC50 |
116 nM
|
[105] |
| Toxin Info Plant defensin 2.3 (G36N) | IC50 |
138 nM
|
[106] |
| Toxin Info PI-stichotoxin-Hcr2f | IC50 |
154.9 nM
|
[97] |
| Toxin Info PI-stichotoxin-Hcr2f | IC50 |
154.9 nM
|
[98], [97], [99] |
| Toxin Info Kappa-actitoxin-Ate1a | IC50 |
191 nM
|
[107] |
| Toxin Info Potassium channel toxin alpha-KTx 3.18 | IC50 |
266.3 nM
|
[77- 96] |
| Toxin Info Plant defensin 2.3 (K33A,G36N) | IC50 |
366 nM
|
[106] |
| Toxin Info Potassium channel toxin AbeTx1 (R,R10A) | IC50 |
811 nM
|
[105] |
| Toxin Info Potassium channel toxin AbeTx1 (R,K6A) | IC50 |
852 nM
|
[105] |
| Toxin Info Potassium channel toxin alpha-KTx 1.17 | IC50 |
910 nM
|
[108] |
| Toxin Info Potassium channel toxin alpha-KTx 1.17 | IC50 |
910 nM
|
[33- 108] |
| Toxin Info Defensin-like protein 1 | IC50 |
978 nM
|
[106] |
| Toxin Info Potassium channel toxin AbeTx1 (R,K12A) | IC50 |
1.077 μM
|
[105] |
| Toxin Info Toxin MeKTx13-3 (Q12A,K15A,K18A,D33R) | IC50 |
1.522 μM
|
[100] |
| Toxin Info Kappa-actitoxin-Bcs4a | IC50 |
2.24593 μM
|
[109] |
| Toxin Info Kappa-actitoxin-Bcs4a | IC50 |
2.24593 μM
|
[109] |
| Toxin Info Potassium channel toxin AbeTx1 (R,R8A) | IC50 |
2.442 μM
|
[105] |
| Toxin Info Plant defensin 2.3 (K33A) | IC50 |
3.5 μM
|
[106] |
| Toxin Info Potassium channel toxin AbeTx1 (A) | IC50 |
3.531 μM
|
[105] |
| Toxin Info Toxin MeKTx11-3 (V9G) | IC50 |
6 μM
|
[108] |
| Toxin Info U-actitoxin-Oulsp1 | IC50 |
6.542 μM
|
[110] |
| Toxin Info Toxin MeKTx11-3 (S37P) | IC50 |
6.9 μM
|
[108] |
| Toxin Info Potassium channel toxin alpha-KTx 1.16 | IC50 |
8.9 μM
|
[33- 108] |
| Toxin Info Potassium channel toxin alpha-KTx 1.16 | IC50 |
8.9 μM
|
[108] |
| Toxin Info Potassium channel toxin alpha-KTx 8.8 | IC50 |
9.983 μM
|
[111] |
| Toxin Info Potassium channel toxin alpha-KTx 8.8 | IC50 |
9.983 μM
|
[111] |
| Toxin Info Potassium channel toxin AbeTx1 (R,K2A) | IC50 |
18.857 μM
|
[105] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
