Target Information

General Information of This Target
Target ID
BTDT00137
Target Name
Sodium channel protein type 5 subunit alpha (SCN5A)
Target Bioclass
Transporter and channel
Uniprot ID
Q14524
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
SCN5A
Gene ID
6331
Synonym
Sodium channel protein cardiac muscle subunit alpha; Sodium channel protein type V subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.5; hH1
Sequence
MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSTTLQESREGLPEEEAPRPQLDLQA
SKKLPDLYGNPPQELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPI
RRAAVKILVHSLFNMLIMCTILTNCVFMAQHDPPPWTKYVEYTFTAIYTFESLVKILARG
FCLHAFTFLRDPWNWLDFSVIIMAYTTEFVDLGNVSALRTFRVLRALKTISVISGLKTIV
GALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTALNGTNGSVEADGLV
WESLDLYLSDPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFAW
AFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQN
QATIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSRSSLEMSPLAPVNSHERRSKRRK
RMSSGTEECGEDRLPKSDSEDGPRAMNHLSLTRGLSRTSMKPRSSRGSIFTFRRRDLGSE
ADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALHGKKNSTVDCNGV
VSLLGAGDPEATSPGSHLLRPVMLEHPPDTTTPSEEPGGPQMLTSQAPCVDGFEEPGARQ
RALSAVSVLTSALEELEESRHKCPPCWNRLAQRYLIWECCPLWMSIKQGVKLVVMDPFTD
LTITMCIVLNTLFMALEHYNMTSEFEEMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQG
WNIFDSIIVILSLMELGLSRMSNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALG
NLTLVLAIIVFIFAVVGMQLFGKNYSELRDSDSGLLPRWHMMDFFHAFLIIFRILCGEWI
ETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDREMNNLQ
LALARIQRGLRFVKRTTWDFCCGLLRQRPQKPAALAAQGQLPSCIATPYSPPPPETEKVP
PTRKETRFEEGEQPGQGTPGDPEPVCVPIAVAESDTDDQEEDEENSLGTEEESSKQQESQ
PVSGGPEAPPDSRTWSQVSATASSEAEASASQADWRQQWKAEPQAPGCGETPEDSCSEGS
TADMTNTAELLEQIPDLGQDVKDPEDCFTEGCVRRCPCCAVDTTQAPGKVWWRLRKTCYH
IVEHSWFETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLKWVA
YGFKKYFTNAWCWLDFLIVDVSLVSLVANTLGFAEMGPIKSLRTLRALRPLRALSRFEGM
RVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNN
KSQCESLNLTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQW
EYNLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKK
LGSKKPQKPIPRPLNKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKINIL
AKINLLFVAIFTGECIVKLAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQKYFFSPT
LFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMANFA
YVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPTLPNSNGSRG
DCGSPAVGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEK
FDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKR
VLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRS
LKHASFLFRQQAGSGLSEEDAPEREGLIAYVMSENFSRPLGPPSSSSISSTSFPPSYDSV
TRATSDNLQVRGSDYSHSEDLADFPPSPDRDRESIV

    Click to Show/Hide
Family
the sodium channel (TC 1.A.1.10) family
Function
This protein mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-resistant Na(+) channel isoform. This channel is responsible for the initial upstroke of the action potential. Channel inactivation is regulated by intracellular calcium levels.

    Click to Show/Hide
Taxonomy ID
9606
TCDB ID
1.A.1.10.3
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    N.vectensis toxin 4 Effect . [1]
 Toxin Info    N.vectensis toxin 5 Effect . [1]
 Toxin Info    U1-theraphotoxin-Ap1a Inhibition rate . [2]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 Inhibition rate . [3- 7]
 Toxin Info    Mu-conotoxin SxIIIC Inhibition rate . [8]
 Toxin Info    Mu-theraphotoxin-Phlo1a Inhibition rate
<20 %
 [9]
 Toxin Info    Mu-theraphotoxin-Phlo1b Inhibition rate
<20 %
 [9]
 Toxin Info    Mu-conotoxin SrVA Inhibition rate
33 %
 [10], [11], [12]
 Toxin Info    Mu-conotoxin SrVA Inhibition rate
50 %
 [10], [11], [12]
 Toxin Info    Mu-conotoxin SrVA Inhibition rate
55 %
 [10], [11], [12]
 Toxin Info    Beta-toxin Tf1a Inhibition rate
71 %
 [13]
 Toxin Info    Nemertide alpha-4 Effective concentration 50
14.6 nM
 [14], [15]
 Toxin Info    Nemertide alpha-5 Effective concentration 50
15.4 nM
 [14], [15]
 Toxin Info    Nemertide alpha-6 Effective concentration 50
46.4 nM
 [14], [15]
 Toxin Info    Nemertide alpha-1 Effective concentration 50
138.3 nM
 [14], [15], [16]
 Toxin Info    Nemertide alpha-1 Effective concentration 50
138.3 nM
 [14], [15], [16]
 Toxin Info    Nemertide alpha-2 Effective concentration 50
149.2 nM
 [14], [15]
 Toxin Info    Nemertide alpha-3 Effective concentration 50
150.2 nM
 [14], [15]
 Toxin Info    Nemertide alpha-3 Effective concentration 50
150.2 nM
 [14], [15]
 Toxin Info    Nemertide alpha-7 Effective concentration 50
810.6 nM
 [14], [15]
 Toxin Info    Nemertide alpha-2 Effective concentration 50
1.1503 μM
 [14], [15]
 Toxin Info    Alpha-mammal toxin AnCra1 Effective concentration 50
31.9 μM
 [17]
 Toxin Info    O- MrVIA IC50
3.9 ± 0.9 mM
 [18]
 Toxin Info    Mu-theraphotoxin-Phlo2a IC50
218 nM
 [9]
 Toxin Info    Delta-theraphotoxin-Cg1a 2 IC50
335 nM
 [19- 25]
 Toxin Info    Delta-theraphotoxin-Cg1a 3 IC50
335 nM
 [19- 25]
 Toxin Info    Delta-theraphotoxin-Cg1a 1 IC50
335 nM
 [20- 26]
 Toxin Info    Mu-theraphotoxin-Pn3a IC50
800 nM
 [27- 32]
 Toxin Info    GPTX1 (Phe5 Gly) IC50
>1 μM
 [33]
 Toxin Info    GPTX1 (Phe5 Ile) IC50
>1 μM
 [33]
 Toxin Info    GPTX1 (Phe5 Leu) IC50
>1 μM
 [33]
 Toxin Info    Huwentoxin-IV IC50
≥10 - 25 μM
 [30- 48]
 Toxin Info    GPTX1 (Phe5 Met) IC50
>1 μM
 [33]
 Toxin Info    GPTX1 (Phe5 Val) IC50
>1 μM
 [33]
 Toxin Info    GPTX1 (Phe5Ala) IC50
>1 μM
 [33]
 Toxin Info    Mu-theraphotoxin-Os1a IC50
>10 μM
 [49]
 Toxin Info    GPTX1 (Arg18Ala) IC50
>20 μM
 [50]
 Toxin Info    GPTX1 (Leu21Ala) IC50
>20 μM
 [51]
 Toxin Info    GPTX1 (Pro19Ala) IC50
>20 μM
 [50]
 Toxin Info    GPTX1 (Asp12Lys) IC50
>4.7 μM
 [52]
 Toxin Info    GPTX1 (Ser24Ala) IC50
>4.7 μM
 [53]
 Toxin Info    GPTX1 (Asp12Arg) IC50
>4.8 μM
 [52]
 Toxin Info    GPTX1 (Arg18Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Arg18Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Arg25Ala) IC50
>5 μM
 [54]
 Toxin Info    GPTX1 (Arg25Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Arg25Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Arg7-Ala) IC50
>5 μM
 [55]
 Toxin Info    GPTX1 (Arg7-Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Arg7-Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asn13Ala) IC50
>5 μM
 [56]
 Toxin Info    GPTX1 (Asn13Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asn13Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asn13Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asn20Ala) IC50
>5 μM
 [51]
 Toxin Info    GPTX1 (Asn20Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asn20Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asn20Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asn20Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asp12Ala) IC50
>5 μM
 [57]
 Toxin Info    GPTX1 (Asp12Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asp12Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asp1Ala) IC50
>5 μM
 [58]
 Toxin Info    GPTX1 (Asp1Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asp1Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asp1Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asp1Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (C-Term. -Ala) IC50
>5 μM
 [59]
 Toxin Info    GPTX1 (C-Term. -Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (C-Term. -Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (C-Term. -Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Gly4Ala) IC50
>5 μM
 [60]
 Toxin Info    GPTX1 (Gly4Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Gly4Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Gly4Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Gly4Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (His27Ala) IC50
>5 μM
 [61]
 Toxin Info    GPTX1 (His27Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (His27Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (His27Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (His27Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Ala) IC50
>5 μM
 [62]
 Toxin Info    GPTX1 (Ile10Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Leu21Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Leu3Ala) IC50
>5 μM
 [58]
 Toxin Info    GPTX1 (Leu3Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Leu3Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Leu3Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Lys15Ala) IC50
>5 μM
 [56]
 Toxin Info    GPTX1 (Lys15Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Lys15Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Lys28Ala) IC50
>5 μM
 [61]
 Toxin Info    GPTX1 (Lys28Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Lys28Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Lys31Ala) IC50
>5 μM
 [63]
 Toxin Info    GPTX1 (Lys31Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Lys31Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Lys31Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Lys8Ala) IC50
>5 μM
 [62]
 Toxin Info    GPTX1 (Lys8Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Lys8Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Met6Ala) IC50
>5 μM
 [55]
 Toxin Info    GPTX1 (Met6Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Met6Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Met6Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Phe34Ala) IC50
>5 μM
 [59]
 Toxin Info    GPTX1 (Phe34Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Phe34Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Phe34Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Phe34Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Phe5Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Phe5Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Phe5Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Pro11Ala) IC50
>5 μM
 [57]
 Toxin Info    GPTX1 (Pro11Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Pro11Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Pro19Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Pro19Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ser24Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Thr26Ala) IC50
>5 μM
 [54]
 Toxin Info    GPTX1 (Thr26Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Thr26Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Trp29Ala) IC50
>5 μM
 [63]
 Toxin Info    GPTX1 (Trp29Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Trp29Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Trp29Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Tyr32Ala) IC50
>5 μM
 [64]
 Toxin Info    GPTX1 (Tyr32Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Tyr32Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Tyr32Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Tyr32Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Val22Ala) IC50
>5 μM
 [53]
 Toxin Info    GPTX1 (Val22Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Val22Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Val22Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Val22Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Val33Ala) IC50
>5 μM
 [64]
 Toxin Info    GPTX1 (Val33Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Val33Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Val33Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Val33Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10 2-Pal) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10 4-CO2-F) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Asn) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Asp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10His) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Leu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Phe) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Ser) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Thr) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Tyr) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Ile10Val) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (N-Term. Arg) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (N-Term. Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (N-Term. Trp) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Arg18Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (Asn13Lys) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (C-Term. -Glu) IC50
>5 μM
 [52]
 Toxin Info    GPTX1 (N-Term. Ala) IC50
>5 μM
 [65]
 Toxin Info    GPTX1 (N-Term. Ala) IC50
>5 μM
 [52]
 Toxin Info    JZTX-XI IC50
0.124 ± 0.026 μM
 [66]
 Toxin Info    JZTX-II IC50
0.26 ± 0.09 μM
 [52]
 Toxin Info    U18-theraphotoxin-Cg1a IC50
0.45 μM
 [19- 67]
 Toxin Info    O-MrVIB IC50
1 μM
 [68]
 Toxin Info    PnCS2 IC50
2.8 ± 0.6 μM
 [69]
 Toxin Info    GPTX1 (Ile10Met) IC50
3.4 μM
 [52]
 Toxin Info    GPTX1 (Met6Trp) IC50
3.4 ± 0.6 μM
 [52]
 Toxin Info    GPTX1 (Thr26Arg) IC50
3.5 ± 0.5 μM
 [52]
 Toxin Info    GPTX1 (Thr26Trp) IC50
3.6 ± 1.1 μM
 [52]
 Toxin Info    PnCS4 IC50
4.5 ± 0.4 μM
 [69]
 Toxin Info    PnM1 IC50
5.3 ± 0.6 μM
 [69]
 Toxin Info    PnM8 IC50
8.3 ± 2.1 μM
 [69]
 Toxin Info    Mu-elapitoxin-Na1a IC50
8.51 μM
 [70]
 Toxin Info    PnM5 IC50
9.8 ± 1.1 μM
 [69]
 Toxin Info    PnM2 IC50
10.4 ± 2.1 μM
 [69]
 Toxin Info    GPTX1 (Phe5Ala) IC50
27 ± 10 μM
 [60]
 Toxin Info    PnCS3 IC50
30.4 ± 4.5 μM
 [69]
 Toxin Info    PTx2-3258 IC50
38.315 μM
 [71]
 Toxin Info    PTx2-3127 IC50
137.09 μM
 [72]
References
Ref 1 The Birth and Death of Toxins with Distinct Functions: A Case Study in the Sea Anemone Nematostella. Mol Biol Evol. 2019 Sep 1;36(9):2001-2012. doi: 10.1093/molbev/msz132.
Ref 2 Characterization of a novel peptide toxin from Acanthoscurria paulensis spider venom: a distinct cysteine assignment to the HWTX-II family. Biochemistry. 2013 Apr 9;52(14):2440-52. doi: 10.1021/bi4000035. Epub 2013 Mar 29.
Ref 3 Proteomic endorsed transcriptomic profiles of venom glands from Tityus obscurus and T. serrulatus scorpions. PLoS One. 2018 Mar 21;13(3):e0193739. doi: 10.1371/journal.pone.0193739. eCollection 2018.
Ref 4 Novel components of Tityus serrulatus venom: A transcriptomic approach. Toxicon. 2021 Jan 15;189:91-104. doi: 10.1016/j.toxicon.2020.11.001. Epub 2020 Nov 10.
Ref 5 Purification and characterization of Ts15, the first member of a new -KTX subfamily from the venom of the Brazilian scorpion Tityus serrulatus. Toxicon. 2011 Jul;58(1):54-61. doi: 10.1016/j.toxicon.2011.05.001. Epub 2011 May 13.
Ref 6 Moving pieces in a venomic puzzle: unveiling post-translationally modified toxins from Tityus serrulatus. J Proteome Res. 2013 Jul 5;12(7):3460-70. doi: 10.1021/pr4003068. Epub 2013 Jun 13.
Ref 7 Influence of post-starvation extraction time and prey-specific diet in Tityus serrulatus scorpion venom composition and hyaluronidase activity. Toxicon. 2014 Nov;90:326-36. doi: 10.1016/j.toxicon.2014.08.064. Epub 2014 Sep 6.
Ref 8 Discovery, Pharmacological Characterisation and NMR Structure of the Novel -Conotoxin SxIIIC, a Potent and Irreversible Na(V) Channel Inhibitor. Biomedicines. 2020 Oct 2;8(10):391. doi: 10.3390/biomedicines8100391.
Ref 9 Three Peptide Modulators of the Human Voltage-Gated Sodium Channel 1.7, an Important Analgesic Target, from the Venom of an Australian Tarantula. Toxins (Basel). 2015 Jun 30;7(7):2494-513. doi: 10.3390/toxins7072494.
Ref 10 Identification, by RT-PCR, of four novel T-1-superfamily conotoxins from the vermivorous snail Conus spurius from the Gulf of Mexico. Peptides. 2009 Aug;30(8):1396-404. doi: 10.1016/j.peptides.2009.05.003. Epub 2009 May 15.
Ref 11 A biologically active hydrophobic T-1-conotoxin from the venom of Conus spurius. Peptides. 2006 Mar;27(3):500-5. doi: 10.1016/j.peptides.2005.07.020. Epub 2005 Nov 16.
Ref 12 The T-1 conotoxin -SrVA from the worm hunting marine snail Conus spurius preferentially blocks the human Na(V)1.5 channel. Peptides. 2022 Oct;156:170859. doi: 10.1016/j.peptides.2022.170859. Epub 2022 Aug 5.
Ref 13 Subtype Specificity of -Toxin Tf1a from Tityus fasciolatus in Voltage Gated Sodium Channels. Toxins (Basel). 2018 Aug 22;10(9):339. doi: 10.3390/toxins10090339.
Ref 14 Peptide ion channel toxins from the bootlace worm, the longest animal on Earth. Sci Rep. 2018 Mar 22;8(1):4596. doi: 10.1038/s41598-018-22305-w.
Ref 15 Functional Characterization of the Nemertide Family of Peptide Toxins. J Nat Prod. 2021 Aug 27;84(8):2121-2128. doi: 10.1021/acs.jnatprod.1c00104. Epub 2021 Aug 16.
Ref 16 Compound Heterozygous SCN5A Mutations in Severe Sodium Channelopathy With Brugada Syndrome: A Case Report. Front Cardiovasc Med. 2020 Jul 24;7:117. doi: 10.3389/fcvm.2020.00117. eCollection 2020.
Ref 17 Expression and purification of recombinant alpha-toxin AnCra1 from the scorpion Androctonus crassicauda and its functional characterization on mammalian sodium channels. Mol Biol Rep. 2021 Sep;48(9):6303-6312. doi: 10.1007/s11033-021-06624-2. Epub 2021 Aug 11.
Ref 18 Isolation, characterization and total regioselective synthesis of the novel O-conotoxin MfVIA from Conus magnificus that targets voltage-gated sodium channels. Biochem Pharmacol. 2012 Aug 15;84(4):540-8. doi: 10.1016/j.bcp.2012.05.008. Epub 2012 May 16.
Ref 19 Molecular diversity and evolution of cystine knot toxins of the tarantula Chilobrachys jingzhao. Cell Mol Life Sci. 2008 Aug;65(15):2431-44. doi: 10.1007/s00018-008-8135-x.
Ref 20 Proteomic and peptidomic analysis of the venom from Chinese tarantula Chilobrachys jingzhao. Proteomics. 2007 Jun;7(11):1892-907. doi: 10.1002/pmic.200600785.
Ref 21 Effects and mechanism of Chinese tarantula toxins on the Kv2.1 potassium channels. Biochem Biophys Res Commun. 2007 Jan 19;352(3):799-804. doi: 10.1016/j.bbrc.2006.11.086. Epub 2006 Nov 27.
Ref 22 Characterization of the excitatory mechanism induced by Jingzhaotoxin-I inhibiting sodium channel inactivation. Toxicon. 2007 Sep 15;50(4):507-17. doi: 10.1016/j.toxicon.2007.04.018. Epub 2007 May 3.
Ref 23 Molecular determinants for the tarantula toxin jingzhaotoxin-I interacting with potassium channel Kv2.1. Toxicon. 2013 Mar 1;63:129-36. doi: 10.1016/j.toxicon.2012.12.001. Epub 2012 Dec 13.
Ref 24 Molecular determinant for the tarantula toxin Jingzhaotoxin-I slowing the fast inactivation of voltage-gated sodium channels. Toxicon. 2016 Mar 1;111:13-21. doi: 10.1016/j.toxicon.2015.12.009. Epub 2015 Dec 23.
Ref 25 Sequence-specific assignment of 1H-NMR resonance and determination of the secondary structure of Jingzhaotoxin-I. Acta Biochim Biophys Sin (Shanghai). 2005 Aug;37(8):567-72. doi: 10.1111/j.1745-7270.2005.00078.x.
Ref 26 Jingzhaotoxin-I, a novel spider neurotoxin preferentially inhibiting cardiac sodium channel inactivation. J Biol Chem. 2005 Apr 1;280(13):12069-76. doi: 10.1074/jbc.M411651200. Epub 2004 Nov 17.
Ref 27 Pharmacological characterisation of the highly Na(V)1.7 selective spider venom peptide Pn3a. Sci Rep. 2017 Jan 20;7:40883. doi: 10.1038/srep40883.
Ref 28 Corrigendum: Pharmacological characterisation of the highly Na(V)1.7 selective spider venom peptide Pn3a. Sci Rep. 2017 May 26;7:46816. doi: 10.1038/srep46816.
Ref 29 Antiallodynic effects of the selective NaV1.7 inhibitor Pn3a in a mouse model of acute postsurgical pain: evidence for analgesic synergy with opioids and baclofen. Pain. 2019 Aug;160(8):1766-1780. doi: 10.1097/j.pain.0000000000001567.
Ref 30 Chemical Synthesis, Proper Folding, Na(v) Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. doi: 10.3390/toxins11060367.
Ref 31 Spider Venom Peptide Pn3a Inhibition of Primary Afferent High Voltage-Activated Calcium Channels. Front Pharmacol. 2021 Jan 28;11:633679. doi: 10.3389/fphar.2020.633679. eCollection 2020.
Ref 32 -Theraphotoxin Pn3a inhibition of Ca(V)3.3 channels reveals a novel isoform-selective drug binding site. Elife. 2022 Jul 20;11:e74040. doi: 10.7554/eLife.74040.
Ref 33 Engineering potent and selective analogues of GpTx-1, a tarantula venom peptide antagonist of the Na(V)1.7 sodium channel. J Med Chem. 2015 Mar 12;58(5):2299-314. doi: 10.1021/jm501765v. Epub 2015 Feb 19.
Ref 34 cDNA sequence analysis of seven peptide toxins from the spider Selenocosmia huwena. Toxicon. 2003 Dec;42(7):715-23. doi: 10.1016/j.toxicon.2003.08.007.
Ref 35 Molecular diversification based on analysis of expressed sequence tags from the venom glands of the Chinese bird spider Ornithoctonus huwena. Toxicon. 2008 Jun 15;51(8):1479-89. doi: 10.1016/j.toxicon.2008.03.024. Epub 2008 Mar 27.
Ref 36 Function and solution structure of huwentoxin-IV, a potent neuronal tetrodotoxin (TTX)-sensitive sodium channel antagonist from Chinese bird spider Selenocosmia huwena. J Biol Chem. 2002 Dec 6;277(49):47564-71. doi: 10.1074/jbc.M204063200. Epub 2002 Sep 11.
Ref 37 Native pyroglutamation of huwentoxin-IV: a post-translational modification that increases the trapping ability to the sodium channel. PLoS One. 2013 Jun 24;8(6):e65984. doi: 10.1371/journal.pone.0065984. Print 2013.
Ref 38 Tarantula huwentoxin-IV inhibits neuronal sodium channels by binding to receptor site 4 and trapping the domain ii voltage sensor in the closed configuration. J Biol Chem. 2008 Oct 3;283(40):27300-13. doi: 10.1074/jbc.M708447200. Epub 2008 Jul 14.
Ref 39 Synthesis and characterization of huwentoxin-IV, a neurotoxin inhibiting central neuronal sodium channels. Toxicon. 2008 Feb;51(2):230-9. doi: 10.1016/j.toxicon.2007.09.008. Epub 2007 Sep 29.
Ref 40 The tarantula toxins ProTx-II and huwentoxin-IV differentially interact with human Nav1.7 voltage sensors to inhibit channel activation and inactivation. Mol Pharmacol. 2010 Dec;78(6):1124-34. doi: 10.1124/mol.110.066332. Epub 2010 Sep 20.
Ref 41 Common molecular determinants of tarantula huwentoxin-IV inhibition of Na+ channel voltage sensors in domains II and IV. J Biol Chem. 2011 Aug 5;286(31):27301-10. doi: 10.1074/jbc.M111.246876. Epub 2011 Jun 9.
Ref 42 Potency optimization of Huwentoxin-IV on hNav1.7: a neurotoxin TTX-S sodium-channel antagonist from the venom of the Chinese bird-eating spider Selenocosmia huwena. Peptides. 2013 Jun;44:40-6. doi: 10.1016/j.peptides.2013.03.011. Epub 2013 Mar 19.
Ref 43 Gating modifier toxins isolated from spider venom: Modulation of voltage-gated sodium channels and the role of lipid membranes. J Biol Chem. 2018 Jun 8;293(23):9041-9052. doi: 10.1074/jbc.RA118.002553. Epub 2018 Apr 27.
Ref 44 Screening, large-scale production and structure-based classification of cystine-dense peptides. Nat Struct Mol Biol. 2018 Mar;25(3):270-278. doi: 10.1038/s41594-018-0033-9. Epub 2018 Feb 26.
Ref 45 Analysis of the structural and molecular basis of voltage-sensitive sodium channel inhibition by the spider toxin huwentoxin-IV (-TRTX-Hh2a). J Biol Chem. 2013 Aug 2;288(31):22707-20. doi: 10.1074/jbc.M113.461392. Epub 2013 Jun 12.
Ref 46 Spider peptide toxin HwTx-IV engineered to bind to lipid membranes has an increased inhibitory potency at human voltage-gated sodium channel hNa(V)1.7. Biochim Biophys Acta Biomembr. 2017 May;1859(5):835-844. doi: 10.1016/j.bbamem.2017.01.020. Epub 2017 Jan 20.
Ref 47 The structure, dynamics and selectivity profile of a NaV1.7 potency-optimised huwentoxin-IV variant. PLoS One. 2017 Mar 16;12(3):e0173551. doi: 10.1371/journal.pone.0173551. eCollection 2017.
Ref 48 Structures of human Na(v)1.7 channel in complex with auxiliary subunits and animal toxins. Science. 2019 Mar 22;363(6433):1303-1308. doi: 10.1126/science.aaw2493. Epub 2019 Feb 14.
Ref 49 From identification to functional characterization of cyriotoxin-1a, an antinociceptive toxin from the spider Cyriopagopus schioedtei. Br J Pharmacol. 2019 May;176(9):1298-1314. doi: 10.1111/bph.14628. Epub 2019 Apr 9.
Ref 50 Toscana virus meningitis case in Switzerland: an example of the ezVIR bioinformatics pipeline utility for the identification of emerging viruses. Clin Microbiol Infect. 2015 Apr;21(4):387.e1-4. doi: 10.1016/j.cmi.2014.11.010. Epub 2014 Nov 26.
Ref 51 Ensuring backwards compatibility: traditional genotyping efforts in the era of whole genome sequencing. Clin Microbiol Infect. 2015 Apr;21(4):347.e1-4. doi: 10.1016/j.cmi.2014.11.005. Epub 2014 Nov 25.
Ref 52 Single Residue Substitutions That Confer Voltage-Gated Sodium Ion Channel Subtype Selectivity in the NaV1.7 Inhibitory Peptide GpTx-1. J Med Chem. 2016 Mar 24;59(6):2704-17. doi: 10.1021/acs.jmedchem.5b01947. Epub 2016 Mar 10.
Ref 53 Acute pulmonary exacerbation and lung function decline in patients with cystic fibrosis: high-mobility group box 1 (HMGB1) between inflammation and infection. Clin Microbiol Infect. 2015 Apr;21(4):368.e1-9. doi: 10.1016/j.cmi.2014.11.004. Epub 2014 Nov 15.
Ref 54 Bone marrow CD34+ progenitor cells may harbour HIV-DNA even in successfully treated patients. Clin Microbiol Infect. 2015 Mar;21(3):290.e5-8. doi: 10.1016/j.cmi.2014.11.003. Epub 2014 Nov 11.
Ref 55 Ticking the right boxes: classification of patients suspected of Lyme borreliosis at an academic referral center in the Netherlands. Clin Microbiol Infect. 2015 Apr;21(4):368.e11-20. doi: 10.1016/j.cmi.2014.11.014. Epub 2014 Nov 22.
Ref 56 Matrix-assisted laser desorption ionization time-of-flight mass spectrometry for the rapid identification of yeasts causing bloodstream infections. Clin Microbiol Infect. 2015 Apr;21(4):372-8. doi: 10.1016/j.cmi.2014.11.009. Epub 2014 Nov 20.
Ref 57 Paradoxical immune reconstitution inflammatory syndrome associated with cryptococcal meningitis in China: a 5-year retrospective cohort study. Clin Microbiol Infect. 2015 Apr;21(4):379.e11-4. doi: 10.1016/j.cmi.2014.11.011. Epub 2014 Nov 20.
Ref 58 Collateral damage from oral ciprofloxacin versus nitrofurantoin in outpatients with urinary tract infections: a culture-free analysis of gut microbiota. Clin Microbiol Infect. 2015 Apr;21(4):344.e1-11. doi: 10.1016/j.cmi.2014.11.016. Epub 2014 Nov 25.
Ref 59 Shift in serotype distribution of Shigella species in China, 2003-2013. Clin Microbiol Infect. 2015 Mar;21(3):252.e5-8. doi: 10.1016/j.cmi.2014.10.019. Epub 2014 Nov 7.
Ref 60 European survey on principles of prudent antibiotic prescribing teaching in undergraduate students. Clin Microbiol Infect. 2015 Apr;21(4):354-61. doi: 10.1016/j.cmi.2014.11.015. Epub 2014 Nov 22.
Ref 61 The impact of multimorbidity on short-term events in patients with community-acquired pneumonia: prospective cohort study. Clin Microbiol Infect. 2015 Mar;21(3):264.e7-264.e13. doi: 10.1016/j.cmi.2014.11.002. Epub 2014 Nov 11.
Ref 62 Hepatitis B virus compartmentalization in the cerebrospinal fluid of HIV-infected patients. Clin Microbiol Infect. 2015 Apr;21(4):387.e5-8. doi: 10.1016/j.cmi.2014.11.012. Epub 2014 Nov 23.
Ref 63 Predicting the risk of Clostridium difficile infection following an outpatient visit: development and external validation of a pragmatic, prognostic risk score. Clin Microbiol Infect. 2015 Mar;21(3):256-62. doi: 10.1016/j.cmi.2014.11.001. Epub 2014 Nov 11.
Ref 64 Impact of a hospital-wide multifaceted programme for reducing carbapenem-resistant Enterobacteriaceae infections in a large teaching hospital in northern Italy. Clin Microbiol Infect. 2015 Mar;21(3):242-7. doi: 10.1016/j.cmi.2014.10.020. Epub 2014 Nov 11.
Ref 65 Subcutaneously administered antibiotics: a national survey of current practice from the French Infectious Diseases (SPILF) and Geriatric Medicine (SFGG) society networks. Clin Microbiol Infect. 2015 Apr;21(4):370.e1-3. doi: 10.1016/j.cmi.2014.11.017. Epub 2014 Nov 23.
Ref 66 The tarantula toxin jingzhaotoxin-XI (-theraphotoxin-Cj1a) regulates the activation and inactivation of the voltage-gated sodium channel Nav1.5. Toxicon. 2014 Dec 15;92:6-13. doi: 10.1016/j.toxicon.2014.09.002. Epub 2014 Sep 18.
Ref 67 Jingzhaotoxin-IX, a novel gating modifier of both sodium and potassium channels from Chinese tarantula Chilobrachys jingzhao. Neuropharmacology. 2009 Aug;57(2):77-87. doi: 10.1016/j.neuropharm.2009.04.009. Epub 2009 May 4.
Ref 68 muO-conotoxin MrVIB selectively blocks Nav1.8 sensory neuron specific sodium channels and chronic pain behavior without motor deficits. Proc Natl Acad Sci U S A. 2006 Nov 7;103(45):17030-5. doi: 10.1073/pnas.0601819103. Epub 2006 Oct 31.
Ref 69 Where cone snails and spiders meet: design of small cyclic sodium-channel inhibitors. FASEB J. 2019 Mar;33(3):3693-3703. doi: 10.1096/fj.201801909R. Epub 2018 Dec 3.
Ref 70 Naja atra venom peptide reduces pain by selectively blocking the voltage-gated sodium channel Nav1.8. J Biol Chem. 2019 May 3;294(18):7324-7334. doi: 10.1074/jbc.RA118.007370. Epub 2019 Feb 25.
Ref 71 The alchemy of culture: intoxicants in society. BMJ. 1998 Nov 28;317(7171):1532B. doi: 10.1136/bmj.317.7171.1532b.
Ref 72 Computational design of peptides to target Na(V)1.7 channel with high potency and selectivity for the treatment of pain. Elife. 2022 Dec 28;11:e81727. doi: 10.7554/eLife.81727.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.