Peptide Information
General Information of This Peptide
| Peptide ID |
BTDP005408
|
|||||
|---|---|---|---|---|---|---|
| Peptide Name |
Nemertide alpha-7
|
|||||
| Species |
Lineus ruber (Red bootlace) (Poseidon ruber)
|
|||||
| Uniprot Name | ||||||
| 3D Structure |
|
|||||
| Sequence |
GCIPVGSMCTISNGCCTKNCGWNFHCNKPNQ
Click to Show/Hide
|
|||||
| Sequence Length |
31
|
|||||
| Mass (Da) |
3318
|
|||||
| Sequence Removed Signal Peptide |
GCIPVGSMCTISNGCCTKNCGWNFHCNKPNQ
Click to Show/Hide
|
|||||
| Disulfide Bond |
2-16;9-20;15-26
|
|||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Full List of Activity Data of This Peptide Toxin
| Target Name | Activity Data Type | Activity Data | Concentration | Note | Reference |
|---|---|---|---|---|---|
| Target Info BgNav1 | Effective concentration 50 |
9.5 nM
|
. | . | [1], [2] |
| Target Info Nav1.3 | Effective concentration 50 |
50.4 nM
|
. | . | [1], [2] |
| Target Info Nav1.1 | Effective concentration 50 |
129 nM
|
. | . | [1], [2] |
| Target Info Nav1.9 | Effective concentration 50 |
147.6 nM
|
. | . | [1], [2] |
| Target Info Nav1.6 | Effective concentration 50 |
155.6 nM
|
. | . | [1], [2] |
| Target Info Nav1.4 | Effective concentration 50 |
170.2 nM
|
. | . | [1], [2] |
| Target Info Nav1.2 | Effective concentration 50 |
171.5 nM
|
. | . | [1], [2] |
| Target Info Nav1.5 | Effective concentration 50 |
810.6 nM
|
. | . | [1], [2] |
| Target Info Nav | Effective concentration 50 |
6.1 μM
|
. | . | [1], [2] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
