General Information of This Target
Target ID
BTDT00031
Target Name
Immunoglobulin kappa variable 1-39 (IGKV1-39)
Target Bioclass
Immunoglobulin
Uniprot ID
P01597
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
IGKV1-39
Synonym
Ig kappa chain V-I region DEE; Ig kappa chain V-I region Hau; Ig kappa chain V-I region Mev; Ig kappa chain V-I region OU; Ig kappa chain V-I region Walker
Sequence
MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQ
KPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTP

    Click to Show/Hide
Function
V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen.

    Click to Show/Hide
Taxonomy ID
9606
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Venom basic protease inhibitor 1 homolog (L3R,Q18D,G34R,T36D,R59G) Dissociation constant
0.024 nM
[1]
 Toxin Info    Bgk (W5Y,Y26F) Dissociation constant
0.035 nM
[1]
 Toxin Info    Potassium channel toxin Bgk (W5Y,F6A,Y26F) Dissociation constant
0.088 nM
[1]
 Toxin Info    Potassium channel toxin ShK (C3[Abu],C39[Abu]) Dissociation constant
1.045 nM
[2]
 Toxin Info    Potassium channel toxin alpha-KTx 2.2 Dissociation constant
4.2 nM
[3]
 Toxin Info    Kappa-actitoxin-Bgr1a Dissociation constant
6 nM
[4]
 Toxin Info    Potassium channel toxin ShK (C12[Abu],C28[Abu]) Dissociation constant
23.45 nM
[2]
 Toxin Info    Potassium channel toxin ShK (C17[Abu],T32[Abu]) Dissociation constant
51.46 nM
[2]
 Toxin Info    Potassium channel toxin alpha-KTx 32.1 Dissociation constant
400 nM
[5]
 Toxin Info    Potassium channel toxin kappa-KTx 2.5 Dissociation constant
217 μM
[6]
 Toxin Info    Kappa-actitoxin-Bgr1a Inhibition constant
0.034 nM
[1]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) Inhibition constant
0.059 nM
[7]
 Toxin Info    Bgk (W5Y,Y26F) Inhibition constant
0.104 nM
[1]
 Toxin Info    Bgk (W5Y,F6A,Y26F) Inhibition constant
0.215 nM
[1]
 Toxin Info    Potassium channel toxin ShK (D5[Nal]) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (F27R) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (I7K) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (K22[Nal]) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (K22E) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (K22R) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (Q16[Nal]) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (R11R[Abu],Q16Q[CAcm],F27F[Abu],T31T[CAcm]) Inhibition rate . [2]
 Toxin Info    Potassium channel toxin ShK (R29[Nal]) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (S20[Nal]) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (S20E) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (S20R) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (Y23[Nal]) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (Y23A) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (Y23E) Inhibition rate . [8]
 Toxin Info    Potassium channel toxin ShK (Y23R) Inhibition rate . [8]
 Toxin Info    Beta-theraphotoxin-Gr1a Inhibition rate . [9], [10], [11], [12]
 Toxin Info    Beta-theraphotoxin-Gr1b Inhibition rate . [10], [11], [12]
 Toxin Info    Defensin domain protein Inhibition rate . [13]
 Toxin Info    U-actitoxin-Oulsp2 Inhibition rate . [14]
 Toxin Info    Kappa-conotoxin RIIIK Inhibition rate . [15]
 Toxin Info    Kappa-theraphotoxin-Gr2c Inhibition rate . [10- 16]
 Toxin Info    Kunitz-type conkunitzin-S1 Inhibition rate . [17], [18], [19]
 Toxin Info    Potassium channel toxin alpha-KTx 10.4 Inhibition rate . [20]
 Toxin Info    Potassium channel toxin alpha-KTx 4.8 Inhibition rate . [21]
 Toxin Info    Kappa-LhTx-1 Inhibition rate . [22]
 Toxin Info    Potassium channel toxin alpha-KTx 2.15 Inhibition rate . [20]
 Toxin Info    Potassium channel toxin alpha-KTx 2.16 Inhibition rate . [20]
 Toxin Info    Potassium channel toxin alpha-KTx 24.1 Inhibition rate . [23]
 Toxin Info    Potassium channel toxin kappa-KTx 2.9 Inhibition rate . [23]
 Toxin Info    Potassium channel gamma toxin gamma-KTx 1.9 Inhibition rate . [20]
 Toxin Info    Kappa-actitoxin-Ael2e Inhibition rate . [24]
 Toxin Info    U-actitoxin-Avd3n Inhibition rate . [25]
 Toxin Info    Toxin VmKTx1 Inhibition rate . [26]
 Toxin Info    Contryphan-Vn Inhibition rate . [27], [28], [29]
 Toxin Info    Kappa-theraphotoxin-Gr3a Inhibition rate . [10- 34]
 Toxin Info    M-theraphotoxin-Gr1a Inhibition rate . [10- 45]
 Toxin Info    Conotoxin PlXIVA Inhibition rate
0.8 %
[46]
 Toxin Info    Kcug1 Inhibition rate
0.9 %
[47]
 Toxin Info    Kcug1 (C1V,T2K,A3C,S4T,K5A,Q6S,C7K,W8Q,P9C,V10W,C11P,N12V,Q13C,M14N,F15Q,G16M,K17F,P18G,N19K,G20P,K21N,C22G,M23K,N24C,G25M,K26N,C27G,R28K) Inhibition rate
1.6 %
[47]
 Toxin Info    Kcug1 (C1T,T2D,A3V,S4K,K5C,Q6T,C7A,W8S,P9K,V10Q,N12W,Q13P,M14V,F15C,G16N,K17Q,P18M,N19F,C22P,M23N,N24G,G25K,K26C,C27M,R28N,C29G) Inhibition rate
1.9 %
[47]
 Toxin Info    Kcug1 (C1K,T2C,A3T,S4A,K5S,Q6K,C7Q,W8C,P9W,V10P,C11V,N12C,Q13N,M14Q,F15M,G16F,K17G,P18K,N19P,G20N,K21G,C22K,M23C,N24M,G25N,K26G,C27K,R28C,C29R) Inhibition rate
2.5 %
[47]
 Toxin Info    BmK86-P9 Inhibition rate
3 %
[46]
 Toxin Info    ChTX (M29I) Inhibition rate
3.1 %
[48]
 Toxin Info    CboK2 (D2N,K6R,R7K,R8K,N18G,A19R) Inhibition rate
4 %
[49]
 Toxin Info    BmK86-P1 Inhibition rate
4 %
[46]
 Toxin Info    Potassium channel toxin alpha-KTx 1.15 Inhibition rate
4 %
[47]
 Toxin Info    Potassium channel toxin Bgk (N19A) Inhibition rate
6 %
[50]
 Toxin Info    Potassium channel toxin Bgk (K25A) Inhibition rate
7 %
[50]
 Toxin Info    Potassium channel toxin Bgk (Y26A) Inhibition rate
8 %
[50]
 Toxin Info    Beta-defensin 3 Inhibition rate
9 %
[51]
 Toxin Info    Defensin BmKDfsin5 Inhibition rate
9 %
[52]
 Toxin Info    Potassium channel toxin Bgk (N29A) Inhibition rate
18 %
[50]
 Toxin Info    Potassium channel toxin Bgk (Q24A) Inhibition rate
19 %
[50]
 Toxin Info    Potassium channel toxin Bgk (S23A) Inhibition rate
23 %
[50]
 Toxin Info    Potassium channel toxin Bgk (K7A) Inhibition rate
24 %
[50]
 Toxin Info    Potassium channel toxin Bgk (T22A) Inhibition rate
24 %
[50]
 Toxin Info    Potassium channel toxin Bgk (R27A) Inhibition rate
25 %
[50]
 Toxin Info    Potassium channel toxin Bgk (K32A) Inhibition rate
28 %
[50]
 Toxin Info    Potassium channel toxin Bgk (L36A) Inhibition rate
29 %
[50]
 Toxin Info    Potassium channel toxin Bgk (H13A) Inhibition rate
30 %
[50]
 Toxin Info    Defensin domain protein Inhibition rate
30 %
[13]
 Toxin Info    Potassium channel toxin Bgk (R12A) Inhibition rate
31 %
[50]
 Toxin Info    Potassium channel toxin Bgk (L17A) Inhibition rate
32 %
[50]
 Toxin Info    Potassium channel toxin Bgk (R21A) Inhibition rate
32 %
[50]
 Toxin Info    Potassium channel toxin Bgk (T9A) Inhibition rate
32 %
[50]
 Toxin Info    Potassium channel toxin Bgk (S16A) Inhibition rate
36 %
[50]
 Toxin Info    Potassium channel toxin Bgk (K15A) Inhibition rate
37 %
[50]
 Toxin Info    Potassium channel toxin Bgk (R3A) Inhibition rate
38 %
[50]
 Toxin Info    Potassium channel toxin Bgk (W5A) Inhibition rate
40 %
[50]
 Toxin Info    Potassium channel toxin alpha-KTx 2.14 Inhibition rate
50 %
[53]
 Toxin Info    Defensin BmKDfsin3 Inhibition rate
57 %
[54], [52]
 Toxin Info    Potassium channel toxin Bgk (E8A) Inhibition rate
58 %
[50]
 Toxin Info    Potassium channel toxin Bgk (V1A) Inhibition rate
59 %
[50]
 Toxin Info    Potassium channel toxin Bgk (E35A) Inhibition rate
61 %
[50]
 Toxin Info    Potassium channel toxin Bgk (F6A) Inhibition rate
64 %
[50]
 Toxin Info    Potassium channel toxin Bgk (T33A) Inhibition rate
66 %
[50]
 Toxin Info    Potassium channel toxin ShK (S10[Nal]) IC50
0.9 pM
[8]
 Toxin Info    ShK (S2R) IC50
1 pM
[8]
 Toxin Info    Potassium channel toxin ShK (S26A) IC50
1.1 pM
[8]
 Toxin Info    Potassium channel toxin ShK (L25A) IC50
1.4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (M21A) IC50
1.4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (S2E) IC50
1.5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (H19K) IC50
1.7 pM
[8]
 Toxin Info    Potassium channel toxin ShK (A14R) IC50
1.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (L25R) IC50
1.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (R29E) IC50
1.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (R11A) IC50
2 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T34R) IC50
2 pM
[8]
 Toxin Info    Potassium channel toxin ShK (S20K) IC50
2.1 pM
[8]
 Toxin Info    Potassium channel toxin ShK (Q16A) IC50
2.2 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T31E) IC50
2.3 pM
[8]
 Toxin Info    Potassium channel toxin ShK (R11K) IC50
2.4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T6K) IC50
2.6 pM
[8]
 Toxin Info    Potassium channel toxin ShK (I4A) IC50
2.7 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K9R) IC50
2.7 pM
[8]
 Toxin Info    Potassium channel toxin ShK (H19R) IC50
2.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (L25K) IC50
2.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (P8A) IC50
2.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (S10R) IC50
3 pM
[8]
 Toxin Info    Potassium channel toxin ShK (R1K) IC50
3.1 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K30[Nal]) IC50
3.2 pM
[8]
 Toxin Info    Potassium channel toxin ShK (H19[Nal]) IC50
3.3 pM
[8]
 Toxin Info    Potassium channel toxin ShK (S10K) IC50
3.3 pM
[8]
 Toxin Info    Potassium channel toxin ShK (F27A) IC50
3.4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (S2A) IC50
3.4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K18A) IC50
3.5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (G33R) IC50
3.6 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T34A) IC50
3.7 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K18R) IC50
3.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K18E) IC50
4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (R24K) IC50
4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T31A) IC50
4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (I4[Nal]) IC50
4.2 pM
[8]
 Toxin Info    Potassium channel toxin ShK (I4K) IC50
4.2 pM
[8]
 Toxin Info    Potassium channel toxin ShK (S9E) IC50
4.2 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T13K) IC50
4.4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T34[Nal]) IC50
4.4 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T13E) IC50
4.5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (G33E) IC50
4.9 pM
[8]
 Toxin Info    Potassium channel toxin ShK (A14K) IC50
5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (F15A) IC50
5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (G33A) IC50
5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (G33K) IC50
5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K30A) IC50
5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (R24A) IC50
5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (R8K) IC50
5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T34K) IC50
5.1 pM
[8]
 Toxin Info    Potassium channel toxin ShK (H19A) IC50
5.3 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K30E) IC50
5.7 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K9E) IC50
5.9 pM
[8]
 Toxin Info    Potassium channel toxin ShK (R1[Nal]) IC50
6 pM
[8]
 Toxin Info    Potassium channel toxin ShK (S2[Nal]) IC50
6 pM
[8]
 Toxin Info    Potassium channel toxin ShK (C32[Nal]) IC50
6.1 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T31[Nal]) IC50
6.1 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K18[Nal]) IC50
6.7 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T13A) IC50
6.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (I4R) IC50
7 pM
[8]
 Toxin Info    Potassium channel toxin ShK (P8E) IC50
7.3 pM
[8]
 Toxin Info    Potassium channel toxin ShK (I4E) IC50
7.6 pM
[8]
 Toxin Info    Potassium channel toxin ShK (R1A) IC50
7.7 pM
[8]
 Toxin Info    Potassium channel toxin ShK (A14E) IC50
7.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T6A) IC50
7.8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (K30R) IC50
8 pM
[8]
 Toxin Info    Potassium channel toxin ShK (T34E) IC50
8.3 pM
[8]
 Toxin Info    Potassium channel toxin ShK (S2K) IC50
8.7 pM
[8]
 Toxin Info    Potassium channel toxin ShK (L25[Nal]) IC50
9.1 pM
[8]
 Toxin Info    Potassium channel toxin ShK (I7A) IC50
9.5 pM
[8]
 Toxin Info    Potassium channel toxin ShK (F15[Nal]) IC50
0.0102 nM
[8]
 Toxin Info    Potassium channel toxin ShK (K9[Nal]) IC50
0.011 nM
[8]
 Toxin Info    Potassium channel toxin ShK (K9A) IC50
0.011 nM
[8]
 Toxin Info    Potassium channel toxin ShK (Q16[Dab]) IC50
0.011 nM
[8]
 Toxin Info    Potassium channel toxin ShK (R24E) IC50
0.014 nM
[8]
 Toxin Info    (M21[Nle])ShK IC50
0.015 nM
[8]
 Toxin Info    Potassium channel toxin ShK (F15R) IC50
0.0154 nM
[8]
 Toxin Info    Potassium channel toxin ShK (T13[Nal]) IC50
0.0157 nM
[8]
 Toxin Info    Potassium channel toxin ShK (I7R) IC50
0.0172 nM
[8]
 Toxin Info    Potassium channel toxin ShK (H19E) IC50
0.018 nM
[8]
 Toxin Info    Potassium channel toxin ShK (S20A) IC50
0.0182 nM
[8]
 Toxin Info    Potassium channel toxin ShK (T13R) IC50
0.0195 nM
[8]
 Toxin Info    Potassium channel toxin ShK (L25E) IC50
0.02 nM
[8]
 Toxin Info    Potassium channel toxin ShK (T6E) IC50
0.0256 nM
[8]
 Toxin Info    Potassium channel toxin ShK (M21[Nal]) IC50
0.0262 nM
[8]
 Toxin Info    Potassium channel toxin ShK (R11[Nal]) IC50
0.0274 nM
[8]
 Toxin Info    Potassium channel toxin ShK (S26E) IC50
0.028 nM
[8]
 Toxin Info    Potassium channel toxin ShK (T6[Nal]) IC50
0.028 nM
[8]
 Toxin Info    Potassium channel toxin ShK (R11E) IC50
0.029 nM
[8]
 Toxin Info    Potassium channel toxin ShK (I7E) IC50
0.032 nM
[8]
 Toxin Info    Potassium channel toxin ShK (M21R) IC50
0.0324 nM
[8]
 Toxin Info    Potassium channel toxin ShK (S26K) IC50
0.0335 nM
[8]
 Toxin Info    HD5 (20-94) IC50
0.04 nM
[8]
 Toxin Info    Potassium channel toxin ShK (M21K) IC50
0.04 nM
[8]
 Toxin Info    Potassium channel toxin ShK (F15E) IC50
0.042 nM
[8]
 Toxin Info    Potassium channel toxin ShK (T6R) IC50
0.046 nM
[8]
 Toxin Info    Potassium channel toxin ShK (A14[Nal]) IC50
0.0489 nM
[8]
 Toxin Info    Potassium channel toxin ShK (Q16E) IC50
0.051 nM
[8]
 Toxin Info    Potassium channel toxin ShK (F15K) IC50
0.0527 nM
[8]
 Toxin Info    Potassium channel toxin ShK (Q16R) IC50
0.055 nM
[8]
 Toxin Info    Potassium channel toxin ShK (S26R) IC50
0.07 nM
[8]
 Toxin Info    Potassium channel toxin ShK (F27K) IC50
0.075 nM
[8]
 Toxin Info    Potassium channel toxin ShK (T31K) IC50
0.174 nM
[8]
 Toxin Info    Potassium channel toxin ShK ([pTyr][AEEA]) IC50
0.214 nM
[8]
 Toxin Info    Potassium channel toxin ShK (R29K) IC50
0.266 nM
[8]
 Toxin Info    Potassium channel toxin ShK (I7[Nal]) IC50
0.305 nM
[8]
 Toxin Info    Potassium channel toxin ShK (S10A) IC50
0.308 nM
[8]
 Toxin Info    Potassium channel toxin ShK (R29A) IC50
0.446 nM
[8]
 Toxin Info    Potassium channel toxin ShK (D5K) IC50
0.458 nM
[8]
 Toxin Info    Potassium channel toxin ShK (M21E) IC50
0.49 nM
[8]
 Toxin Info    Potassium channel toxin ShK (T31R) IC50
0.59 nM
[8]
 Toxin Info    ShK (Q16K) IC50
0.6 nM
[8]
 Toxin Info    Potassium channel toxin ShK (Q16[Orn]) IC50
0.74 nM
[8]
 Toxin Info    Potassium channel toxin ShK (K22A) IC50
0.76 nM
[8]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) IC50
0.847 nM
[8]
 Toxin Info    Potassium channel toxin ShK (S26[Nal]) IC50
1.018 nM
[8]
 Toxin Info    Potassium channel toxin ShK (D5E) IC50
1.2 nM
[8]
 Toxin Info    ([20kDa-PEG])-ShK IC50
1.628 nM
[8]
 Toxin Info    Potassium channel toxin ShK (F27E) IC50
1.8 nM
[8]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) IC50
2.3 nM
[7]
 Toxin Info    ShK (Q16K)-amide IC50
2.342 nM
[8]
 Toxin Info    Potassium channel toxin ShK (F27[Nal]) IC50
2.42 nM
[8]
 Toxin Info    Potassium channel toxin ShK (D5R) IC50
3.279 nM
[8]
 Toxin Info    ShK (Q16K)-amide IC50
3.677 nM
[8]
 Toxin Info    Potassium channel toxin alpha-KTx 2.17 IC50
4.8 nM
[20]
 Toxin Info    Potassium channel toxin alpha-KTx 2.17 IC50
4.8 nM
[20]
 Toxin Info    ShK (Q16K)-Ala IC50
9.5 nM
[8]
 Toxin Info    (M21[Nle]-(Lys16)ShK IC50
13.22 nM
[8]
 Toxin Info    (M21[Nle]-(Lys16)ShK-amide IC50
29.258 nM
[8]
 Toxin Info    Potassium channel toxin alpha-KTx 6.21 IC50
253 nM
[55]
 Toxin Info    Potassium channel toxin alpha-KTx 6.21 IC50
253 nM
[55], [56]
 Toxin Info    Toxin MeKTx13-3 (Q12A,K15A,K18A,D33R) IC50
541 nM
[57]
 Toxin Info    ([20kDa-PEG] -(Lys16)-ShK IC50
997 nM
[8]
 Toxin Info    Potassium channel toxin alpha-KTx 2.14 IC50
1 μM
[53]
 Toxin Info    Potassium channel toxin ShK ([30kDa-PEG]) IC50
1.072 μM
[8]
 Toxin Info    Potassium channel toxin ShK ([20kDa-brPEG]) IC50
1.574 μM
[8]
 Toxin Info    Uro IC50
2.77 μM
[56]
 Toxin Info    Potassium channel toxin alpha-KTx 9.4 IC50
4.6 μM
[58]
 Toxin Info    Uro (K25A,T19Q,A25K) IC50
7.7 μM
[56]
 Toxin Info    Potassium channel toxin kappa-KTx 2.5 IC50
217 μM
[6- 60]
 Toxin Info    Uro (K25A) IC50
225.3 μM
[56]
References
Ref 1 Characterization of a novel radiolabeled peptide selective for a subpopulation of voltage-gated potassium channels in mammalian brain. J Biol Chem. 2002 Feb 8;277(6):3886-93. doi: 10.1074/jbc.M109886200. Epub 2001 Nov 13.
Ref 2 Role of disulfide bonds in the structure and potassium channel blocking activity of ShK toxin. Biochemistry. 1999 Nov 2;38(44):14549-58. doi: 10.1021/bi991282m.
Ref 3 Margatoxin is a non-selective inhibitor of human Kv1.3 K+ channels. Toxicon. 2014 Sep;87:6-16. doi: 10.1016/j.toxicon.2014.05.002. Epub 2014 May 28.
Ref 4 A potassium-channel toxin from the sea anemone Bunodosoma granulifera, an inhibitor for Kv1 channels. Revision of the amino acid sequence, disulfide-bridge assignment, chemical synthesis, and biological activity. Eur J Biochem. 1997 Feb 15;244(1):192-202. doi: 10.1111/j.1432-1033.1997.00192.x.
Ref 5 Cm28, a scorpion toxin having a unique primary structure, inhibits KV1.2 and KV1.3 with high affinity. J Gen Physiol. 2022 Aug 1;154(8):e202213146. doi: 10.1085/jgp.202213146. Epub 2022 Jun 14.
Ref 6 The new kappa-KTx 2.5 from the scorpion Opisthacanthus cayaporum. Peptides. 2011 Jul;32(7):1509-17. doi: 10.1016/j.peptides.2011.05.017. Epub 2011 May 23.
Ref 7 Substitution of a single residue in Stichodactyla helianthus peptide, ShK-Dap22, reveals a novel pharmacological profile. Biochemistry. 2003 Nov 25;42(46):13698-707. doi: 10.1021/bi035209e.
Ref 8 Pharmaceutical Optimization of Peptide Toxins for Ion Channel Targets: Potent, Selective, and Long-Lived Antagonists of Kv1.3. J Med Chem. 2015 Sep 10;58(17):6784-802. doi: 10.1021/acs.jmedchem.5b00495. Epub 2015 Aug 31.
Ref 9 Isolation and characterization of a novel toxin from the venom of the spider Grammostola rosea that blocks sodium channels. Toxicon. 2007 Jul;50(1):65-74. doi: 10.1016/j.toxicon.2007.02.015. Epub 2007 Mar 3.
Ref 10 Target promiscuity and heterogeneous effects of tarantula venom peptides affecting Na+ and K+ ion channels. J Biol Chem. 2010 Feb 5;285(6):4130-4142. doi: 10.1074/jbc.M109.054718. Epub 2009 Dec 2.
Ref 11 Structural Basis of Nav1.7 Inhibition by a Gating-Modifier Spider Toxin. Cell. 2019 Feb 7;176(4):702-715.e14. doi: 10.1016/j.cell.2018.12.018. Epub 2019 Jan 17.
Ref 12 Chemical Synthesis, Proper Folding, Na(v) Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. doi: 10.3390/toxins11060367.
Ref 13 Genome and Transcriptome Sequences Reveal the Specific Parasitism of the Nematophagous Purpureocillium lilacinum 36-1. Front Microbiol. 2016 Jul 19;7:1084. doi: 10.3389/fmicb.2016.01084. eCollection 2016.
Ref 14 Synthesis, folding, structure and activity of a predicted peptide from the sea anemone Oulactis sp. with an ShKT fold. Toxicon. 2018 Aug;150:50-59. doi: 10.1016/j.toxicon.2018.05.006. Epub 2018 May 19.
Ref 15 Biochemical characterization of kappaM-RIIIJ, a Kv1.2 channel blocker: evaluation of cardioprotective effects of kappaM-conotoxins. J Biol Chem. 2010 May 14;285(20):14882-14889. doi: 10.1074/jbc.M109.068486. Epub 2010 Mar 10.
Ref 16 Characterization of voltage-dependent calcium channel blocking peptides from the venom of the tarantula Grammostola rosea. Toxicon. 2011 Sep 1;58(3):265-76. doi: 10.1016/j.toxicon.2011.06.006. Epub 2011 Jun 28.
Ref 17 Production of recombinant Conkunitzin-S1 in Escherichia coli. Protein Expr Purif. 2006 Jun;47(2):640-4. doi: 10.1016/j.pep.2006.01.019. Epub 2006 Feb 20.
Ref 18 Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family. Structural and functional characterization. J Biol Chem. 2005 Jun 24;280(25):23766-70. doi: 10.1074/jbc.C500064200. Epub 2005 Apr 15.
Ref 19 Structure of conkunitzin-S1, a neurotoxin and Kunitz-fold disulfide variant from cone snail. Acta Crystallogr D Biol Crystallogr. 2006 Sep;62(Pt 9):980-90. doi: 10.1107/S0907444906021123. Epub 2006 Aug 19.
Ref 20 Isolation, chemical and functional characterization of several new K(+)-channel blocking peptides from the venom of the scorpion Centruroides tecomanus. Toxicon. 2016 Jun 1;115:1-12. doi: 10.1016/j.toxicon.2016.02.017. Epub 2016 Feb 26.
Ref 21 Characterization and Chemical Synthesis of Cm39 (-KTx 4.8): A Scorpion Toxin That Inhibits Voltage-Gated K(+) Channel K(V)1.2 and Small- and Intermediate-Conductance Ca(2+)-Activated K(+) Channels K(Ca)2.2 and K(Ca)3.1. Toxins (Basel). 2023 Jan 5;15(1):41. doi: 10.3390/toxins15010041.
Ref 22 Variation of Two S3b Residues in K(V)4.1-4.3 Channels Underlies Their Different Modulations by Spider Toxin -LhTx-1. Front Pharmacol. 2021 Jun 10;12:692076. doi: 10.3389/fphar.2021.692076. eCollection 2021.
Ref 23 Pi5 and Pi6, two undescribed peptides from the venom of the scorpion Pandinus imperator and their effects on K(+)-channels. Toxicon. 2017 Jul;133:136-144. doi: 10.1016/j.toxicon.2017.05.011. Epub 2017 May 11.
Ref 24 APETx4, a Novel Sea Anemone Toxin and a Modulator of the Cancer-Relevant Potassium Channel K(V)10.1. Mar Drugs. 2017 Sep 13;15(9):287. doi: 10.3390/md15090287.
Ref 25 AsKC11, a Kunitz Peptide from Anemonia sulcata, Is a Novel Activator of G Protein-Coupled Inward-Rectifier Potassium Channels. Mar Drugs. 2022 Feb 15;20(2):140. doi: 10.3390/md20020140.
Ref 26 sVmKTx, a transcriptome analysis-based synthetic peptide analogue of Vm24, inhibits Kv1.3 channels of human T cells with improved selectivity. Biochem Pharmacol. 2022 May;199:115023. doi: 10.1016/j.bcp.2022.115023. Epub 2022 Mar 28.
Ref 27 Contryphan-Vn: a novel peptide from the venom of the Mediterranean snail Conus ventricosus. Biochem Biophys Res Commun. 2001 Nov 9;288(4):908-13. doi: 10.1006/bbrc.2001.5833.
Ref 28 Contryphan-Vn: a modulator of Ca2+-dependent K+ channels. Biochem Biophys Res Commun. 2003 Mar 28;303(1):238-46. doi: 10.1016/s0006-291x(03)00331-0.
Ref 29 Solution structure of the cyclic peptide contryphan-Vn, a Ca2+-dependent K+ channel modulator. Biopolymers. 2004 Jun 15;74(3):189-98. doi: 10.1002/bip.20025.
Ref 30 Functional analysis of an archaebacterial voltage-dependent K+ channel. Nature. 2003 Mar 13;422(6928):180-5. doi: 10.1038/nature01473. Epub 2003 Mar 2.
Ref 31 A membrane-access mechanism of ion channel inhibition by voltage sensor toxins from spider venom. Nature. 2004 Jul 8;430(6996):232-5. doi: 10.1038/nature02632.
Ref 32 Localization of the voltage-sensor toxin receptor on KvAP. Biochemistry. 2004 Aug 10;43(31):10071-9. doi: 10.1021/bi049463y.
Ref 33 Vstx1, a modifier of Kv channel gating, localizes to the interfacial region of lipid bilayers. Biochemistry. 2006 Oct 3;45(39):11844-55. doi: 10.1021/bi061111z.
Ref 34 Solution structure and lipid membrane partitioning of VSTx1, an inhibitor of the KvAP potassium channel. Biochemistry. 2005 Apr 26;44(16):6015-23. doi: 10.1021/bi0477034.
Ref 35 cDNA sequence and in vitro folding of GsMTx4, a specific peptide inhibitor of mechanosensitive channels. Toxicon. 2003 Sep;42(3):263-74. doi: 10.1016/s0041-0101(03)00141-7.
Ref 36 Identification of a peptide toxin from Grammostola spatulata spider venom that blocks cation-selective stretch-activated channels. J Gen Physiol. 2000 May;115(5):583-98. doi: 10.1085/jgp.115.5.583.
Ref 37 Solution structure of peptide toxins that block mechanosensitive ion channels. J Biol Chem. 2002 Sep 13;277(37):34443-50. doi: 10.1074/jbc.M202715200. Epub 2002 Jun 24.
Ref 38 Tarantula peptide inhibits atrial fibrillation. Nature. 2001 Jan 4;409(6816):35-6. doi: 10.1038/35051165.
Ref 39 Bilayer-dependent inhibition of mechanosensitive channels by neuroactive peptide enantiomers. Nature. 2004 Jul 8;430(6996):235-40. doi: 10.1038/nature02743.
Ref 40 Lipid membrane interaction and antimicrobial activity of GsMTx-4, an inhibitor of mechanosensitive channel. Biochem Biophys Res Commun. 2006 Feb 10;340(2):633-8. doi: 10.1016/j.bbrc.2005.12.046. Epub 2005 Dec 19.
Ref 41 Effects of tarantula toxin GsMTx4 on the membrane motor of outer hair cells. Neurosci Lett. 2006 Aug 14;404(1-2):213-6. doi: 10.1016/j.neulet.2006.05.059. Epub 2006 Jun 22.
Ref 42 Molecular dynamics simulations of a stretch-activated channel inhibitor GsMTx4 with lipid membranes: two binding modes and effects of lipid structure. Biophys J. 2007 Jun 15;92(12):4233-43. doi: 10.1529/biophysj.106.101071. Epub 2007 Mar 23.
Ref 43 Is lipid bilayer binding a common property of inhibitor cysteine knot ion-channel blockers?. Biophys J. 2007 Aug 15;93(4):L20-2. doi: 10.1529/biophysj.107.112375. Epub 2007 Jun 15.
Ref 44 Gating modifier toxins isolated from spider venom: Modulation of voltage-gated sodium channels and the role of lipid membranes. J Biol Chem. 2018 Jun 8;293(23):9041-9052. doi: 10.1074/jbc.RA118.002553. Epub 2018 Apr 27.
Ref 45 Fast desensitization of acetylcholine receptors induced by a spider toxin. Channels (Austin). 2021 Dec;15(1):507-515. doi: 10.1080/19336950.2021.1961459.
Ref 46 BmK86-P1, a New Degradation Peptide with Desirable Thermostability and Kv1.2 Channel-Specific Activity from Traditional Chinese Scorpion Medicinal Material. Toxins (Basel). 2021 Aug 30;13(9):610. doi: 10.3390/toxins13090610.
Ref 47 Different pharmacological properties between scorpion toxin BmKcug2 and its degraded analogs highlight the diversity of K(+) channel blockers from thermally processed scorpions. Int J Biol Macromol. 2021 May 1;178:143-153. doi: 10.1016/j.ijbiomac.2021.02.155. Epub 2021 Feb 23.
Ref 48 Gigolaev, A. M., et al. "KV1. 2-Selective Peptide with High Affinity."?Journal of Evolutionary Biochemistry and Physiology?58.6 (2022): 2048-2057.
Ref 49 ImKTx96, a peptide blocker of the Kv1.2 ion channel from the venom of the scorpion Isometrus maculates. Peptides. 2020 Jan;123:170172. doi: 10.1016/j.peptides.2019.170172. Epub 2019 Oct 15.
Ref 50 Mapping the functional anatomy of BgK on Kv1.1, Kv1.2, and Kv1.3. Clues to design analogs with enhanced selectivity. J Biol Chem. 1999 Dec 10;274(50):35653-61. doi: 10.1074/jbc.274.50.35653.
Ref 51 Mouse -Defensin 3, A Defensin Inhibitor of Both Its Endogenous and Exogenous Potassium Channels. Molecules. 2018 Jun 20;23(6):1489. doi: 10.3390/molecules23061489.
Ref 52 Ion channel modulation by scorpion hemolymph and its defensin ingredients highlights origin of neurotoxins in telson formed in Paleozoic scorpions. Int J Biol Macromol. 2020 Apr 1;148:351-363. doi: 10.1016/j.ijbiomac.2020.01.133. Epub 2020 Jan 15.
Ref 53 A K? channel blocking peptide from the Cuban scorpion Rhopalurus garridoi. Peptides. 2014 Mar;53:42-7. doi: 10.1016/j.peptides.2013.10.010. Epub 2013 Oct 25.
Ref 54 The genome of Mesobuthus martensii reveals a unique adaptation model of arthropods. Nat Commun. 2013;4:2602. doi: 10.1038/ncomms3602.
Ref 55 Structure, molecular modeling, and function of the novel potassium channel blocker urotoxin isolated from the venom of the Australian scorpion Urodacus yaschenkoi. Mol Pharmacol. 2014 Jul;86(1):28-41. doi: 10.1124/mol.113.090183. Epub 2014 Apr 10.
Ref 56 Structural basis of the potency and selectivity of Urotoxin, a potent Kv1 blocker from scorpion venom. Biochem Pharmacol. 2020 Apr;174:113782. doi: 10.1016/j.bcp.2019.113782. Epub 2019 Dec 25.
Ref 57 Tuning Scorpion Toxin Selectivity: Switching From K(V)1.1 to K(V)1.3. Front Pharmacol. 2020 Jul 7;11:1010. doi: 10.3389/fphar.2020.01010. eCollection 2020.
Ref 58 BTK-2, a new inhibitor of the Kv1.1 potassium channel purified from Indian scorpion Buthus tamulus. FEBS Lett. 2003 Mar 27;539(1-3):7-13. doi: 10.1016/s0014-5793(03)00125-x.
Ref 59 Cloning and characterization of cDNA sequences encoding for new venom peptides of the Brazilian scorpion Opisthacanthus cayaporum. Toxicon. 2009 Sep 1;54(3):252-61. doi: 10.1016/j.toxicon.2009.04.010. Epub 2009 Apr 18.
Ref 60 Mass spectrometry analysis, amino acid sequence and biological activity of venom components from the Brazilian scorpion Opisthacanthus cayaporum. Toxicon. 2008 Jun 15;51(8):1499-508. doi: 10.1016/j.toxicon.2008.03.029. Epub 2008 Apr 4.
Ref 61 Venom composition and pain-causing toxins of the Australian great carpenter bee Xylocopa aruana. Sci Rep. 2022 Dec 22;12(1):22168. doi: 10.1038/s41598-022-26867-8.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.