Target Information

General Information of This Target
Target ID
BTDT00015
Target Name
Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4)
Target Bioclass
Transporter and channel
Uniprot ID
O15554
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
KCNN4
Gene ID
3783
Synonym
IK1; IKCA1; KCA4; SK4; IKCa1; KCa3.1; KCa4; Putative Gardos channel
Sequence
MGGDLVLGLGALRRRKRLLEQEKSLAGWALVLAGTGIGLMVLHAEMLWFGGCSWALYLFL
VKCTISISTFLLLCLIVAFHAKEVQLFMTDNGLRDWRVALTGRQAAQIVLELVVCGLHPA
PVRGPPCVQDLGAPLTSPQPWPGFLGQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYR
SIGALNQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDT
LWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVARKLEFNKAEKHVHN
FMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRK
LREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLP
EPSQQSK

    Click to Show/Hide
Family
the potassium channel KCNN family
Function
Forms a voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells. Plays a role in the late stages of EGF-induced macropinocytosis.

    Click to Show/Hide
Taxonomy ID
9606
TCDB ID
1.A.1.16.2
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Potassium channel toxin alpha-KTx 23.1 Dissociation constant
0.59 nM
 [1]
 Toxin Info    Potassium channel toxin alpha-KTx 1.1 Dissociation constant
5 nM
 [2]
 Toxin Info    Potassium channel toxin alpha-KTx 1.1 Dissociation constant
5 nM
 [3- 14]
 Toxin Info    ChTX (K32E) Dissociation constant
33 nM
 [2]
 Toxin Info    ChTX (K32[Cpa]) Dissociation constant
35 nM
 [2]
 Toxin Info    ChTX (K32D) Dissociation constant
45 nM
 [2]
 Toxin Info    Potassium channel toxin alpha-KTx 4.8 Dissociation constant
58 nM
 [15]
 Toxin Info    Toxin II.10.4 (T7P,D9Q) Dissociation constant
73 nM
 [16]
 Toxin Info    Potassium channel toxin ShK ([pTyr][AEEA]) Dissociation constant
115 nM
 [17]
 Toxin Info    Kappa-actitoxin-Bgr1a Dissociation constant
172 nM
 [18]
 Toxin Info    Kappa-stichotoxin-She3a Dissociation constant
172 nM
 [18]
 Toxin Info    Potassium channel toxin alpha-KTx 10.1 Dissociation constant
484 nM
 [16]
 Toxin Info    Potassium channel toxin ShK (C3[Abu],C39[Abu]) Dissociation constant
981 nM
 [19]
 Toxin Info    Potassium channel toxin ShK (S20A) Dissociation constant
2.45 μM
 [18]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) Dissociation constant
2.6 μM
 [18]
 Toxin Info    Potassium channel toxin ShK ([Ppa][AEEA],M21[Nle]) Inhibition rate . [20]
 Toxin Info    Martentoxin Inhibition rate . [21]
 Toxin Info    Toxin MeKTx13-3 (D19K) Inhibition rate . [22]
 Toxin Info    Toxin MeKTx13-3 (K6D,D19K) Inhibition rate . [22]
 Toxin Info    OsK1 (E14A,K18D) Inhibition rate . [23]
 Toxin Info    OsK1 (E16A,K20D) Inhibition rate . [23]
 Toxin Info    Anuroctoxin (F32T) Inhibition rate . [24]
 Toxin Info    Anuroctoxin (N17A) Inhibition rate . [24]
 Toxin Info    Anuroctoxin (N17A,F32T) Inhibition rate . [24]
 Toxin Info    MTX (C34[Abu]) Inhibition rate . [25]
 Toxin Info    MTX (K15Q) Inhibition rate . [25]
 Toxin Info    MTX (K23A) Inhibition rate . [25]
 Toxin Info    MTX (K7A) Inhibition rate . [25]
 Toxin Info    MTX (S2A,) Inhibition rate . [25]
 Toxin Info    MTX (S6A) Inhibition rate . [25]
 Toxin Info    MTX (T4A) Inhibition rate . [25]
 Toxin Info    MTX (Y10A) Inhibition rate . [25]
 Toxin Info    MTX (Y32A) Inhibition rate . [25]
 Toxin Info    Neurotoxin HsTX1 Inhibition rate . [26]
 Toxin Info    Potassium channel toxin alpha-KTx 4.6 Inhibition rate . [27]
 Toxin Info    Potassium channel toxin alpha-KTx 32.1 Inhibition rate . [28]
 Toxin Info    U-actitoxin-Oulsp2 Inhibition rate . [29]
 Toxin Info    Potassium channel toxin alpha-KTx 10.4 Inhibition rate . [30]
 Toxin Info    Potassium channel toxin alpha-KTx 2.17 Inhibition rate . [30]
 Toxin Info    Potassium channel toxin alpha-KTx 23.2 Inhibition rate . [31]
 Toxin Info    Potassium channel toxin alpha-KTx 6.12 Inhibition rate . [32]
 Toxin Info    Potassium channel toxin gamma-KTx 2.1 Inhibition rate . [33- 42]
 Toxin Info    Apamin Inhibition rate . [43- 60]
 Toxin Info    Toxin VmKTx1 Inhibition rate . [61]
 Toxin Info    Beta-defensin 103 Inhibition rate . [62]
 Toxin Info    Potassium channel toxin gamma-KTx 2.1 Inhibition rate . [33]
 Toxin Info    Potassium channel gamma toxin gamma-KTx 1.9 Inhibition rate . [30]
 Toxin Info    Potassium channel toxin alpha-KTx 5.4 Inhibition rate . [63]
 Toxin Info    Potassium channel toxin alpha-KTx 2.13 Inhibition rate . [64]
 Toxin Info    Beta-defensin 104 Inhibition rate . [62]
 Toxin Info    Defensin BmKDfsin4 Inhibition rate
4 %
 [65]
 Toxin Info    Defensin alpha 5 Inhibition rate
5 %
 [66]
 Toxin Info    Beta-defensin 1 Inhibition rate
6 %
 [67]
 Toxin Info    Neutrophil defensin 1 Inhibition rate
7 %
 [66]
 Toxin Info    Fungal defensin plectasin Inhibition rate
7 %
 [68]
 Toxin Info    Defensin BmKDfsin3 Inhibition rate
15 %
 [69], [70]
 Toxin Info    Defensin BmKDfsin5 Inhibition rate
17 %
 [70]
 Toxin Info    Potassium channel toxin alpha-KTx 6.2 IC50
1 nM
 [25]
 Toxin Info    MTX (V1W,S2C,C3S,G5C,S6L,K7D,D8L,C9A,Y10C,A11T,P12G,C13S,R14K,K15D,Q16C,T17Y,G18A,C19P,P20C,N21R,A22K,K23Q,C24T,I25G,N26C,K27P,S28N,C29A,Y32I,G33N,C34K) IC50
2.2 nM
 [71]
 Toxin Info    Potassium channel toxin alpha-KTx 2.15 IC50
6.4 nM
 [30]
 Toxin Info    Potassium channel toxin alpha-KTx 2.15 IC50
6.4 nM
 [30]
 Toxin Info    AgTx2 (D20C) IC50
7.3 nM
 [72]
 Toxin Info    MTX (G33A,G34C) IC50
10 nM
 [25]
 Toxin Info    Potassium channel toxin alpha-KTx 12.1 IC50
12.3 nM
 [71]
 Toxin Info    TstBut IC50
12.5 nM
 [71]
 Toxin Info    Kappa-stichotoxin-She3a IC50
28 nM
 [73]
 Toxin Info    Potassium channel toxin alpha-KTx 2.16 IC50
56 nM
 [30]
 Toxin Info    Potassium channel toxin alpha-KTx 2.16 IC50
56 nM
 [30]
 Toxin Info    Potassium channel toxin alpha-KTx 6.21 IC50
70 nM
 [74]
 Toxin Info    Potassium channel toxin alpha-KTx 6.21 IC50
70 nM
 [74], [75]
 Toxin Info    OsK1 (E16K) IC50
151 nM
 [76]
 Toxin Info    Potassium channel toxin alpha-KTx 3.7 IC50
225 nM
 [76]
 Toxin Info    [K16,D20]- OsK1 IC50
228 nM
 [76]
 Toxin Info    MTX (V1A,T4R,G5T,S6P,Y10A,A11D,Q16E,C19,Abu,,N21Y,A22G,I25M,K27R,S28K,Y32N,G33R,C34,Abu,) IC50
340 nM
 [77]
 Toxin Info    OsK1 (E15K,K19D) IC50
425 nM
 [23]
 Toxin Info    MTX (N21Y,A22G,I25M,K27R,S28K,Y32N,G33R) IC50
460 nM
 [78]
 Toxin Info    Potassium channel toxin alpha-KTx 6.3 IC50
625 nM
 [78]
 Toxin Info    OsK1 (K20D) IC50
716 nM
 [76]
 Toxin Info    [K16,D20]- OsK1 IC50
885 nM
 [76]
 Toxin Info    OsK1 (R12P,E16K,K20D) IC50
2.6 μM
 [76]
References
Ref 1 Vm24, a natural immunosuppressive peptide, potently and selectively blocks Kv1.3 potassium channels of human T cells. Mol Pharmacol. 2012 Sep;82(3):372-82. doi: 10.1124/mol.112.078006. Epub 2012 May 23.
Ref 2 Structure-guided transformation of charybdotoxin yields an analog that selectively targets Ca(2+)-activated over voltage-gated K(+) channels. J Biol Chem. 2000 Jan 14;275(2):1201-8. doi: 10.1074/jbc.275.2.1201.
Ref 3 Synthesis of Novel cis-2-Azetidinones from imines and aclychloride using triethylamine. Acta Chim Slov. 2023 Dec 4;70(4):628-633. doi: 10.17344/acsi.2023.8451.
Ref 4 Backward-Eulerian Footprint Modelling Based on the Adjoint Equation for Atmospheric and Urban-Terrain Dispersion. Boundary Layer Meteorol. 2023;188(1):159-183. doi: 10.1007/s10546-023-00807-z. Epub 2023 Apr 17.
Ref 5 Leaf spot on Alocasia macrorrhizos caused by Fusarium asiaticum in Sichuan, China. Plant Dis. 2022 Sep 11. doi: 10.1094/PDIS-04-22-0844-PDN. Online ahead of print.
Ref 6 Incidence and predictors of chronic kidney disease in type-II diabetes mellitus patients attending at the Amhara region referral hospitals, Ethiopia: A follow-up study. PLoS One. 2022 Jan 26;17(1):e0263138. doi: 10.1371/journal.pone.0263138. eCollection 2022.
Ref 7 A Method for More Accurate Determination of Resonance Frequency of the Cardiovascular System, and Evaluation of a Program to Perform It. Appl Psychophysiol Biofeedback. 2022 Mar;47(1):17-26. doi: 10.1007/s10484-021-09524-0. Epub 2021 Oct 16.
Ref 8 First Report of Fusarium wilt of Coleus forskohlii Caused by Fusarium oxysporum in China. Plant Dis. 2021 Jan 26. doi: 10.1094/PDIS-11-20-2489-PDN. Online ahead of print.
Ref 9 Shock waves from the inhomogeneous Boltzmann equation. Phys Rev E. 2019 Dec;100(6-1):062120. doi: 10.1103/PhysRevE.100.062120.
Ref 10 Classifying Changes to Preventive Interventions: Applying Adaptation Taxonomies. J Prim Prev. 2019 Feb;40(1):89-109. doi: 10.1007/s10935-018-00531-2.
Ref 11 Quantification of the passive and active biaxial mechanical behaviour and microstructural organization of rat thoracic ducts. J R Soc Interface. 2015 Jul 6;12(108):20150280. doi: 10.1098/rsif.2015.0280.
Ref 12 A model of mechanical interactions between heart and lungs. Philos Trans A Math Phys Eng Sci. 2009 Dec 13;367(1908):4741-57. doi: 10.1098/rsta.2009.0137.
Ref 13 Experimental test of nonlocal realistic theories without the rotational symmetry assumption. Phys Rev Lett. 2007 Nov 23;99(21):210406. doi: 10.1103/PhysRevLett.99.210406. Epub 2007 Nov 21.
Ref 14 Structures and phase transitions of the A7PSe6 (A = ag, Cu) argyrodite-type ionic conductors. III. alpha-Cu7PSe6. Acta Crystallogr B. 2000 Dec;56 (Pt 6):972-9. doi: 10.1107/s0108768100010260.
Ref 15 Characterization and Chemical Synthesis of Cm39 (-KTx 4.8): A Scorpion Toxin That Inhibits Voltage-Gated K(+) Channel K(V)1.2 and Small- and Intermediate-Conductance Ca(2+)-Activated K(+) Channels K(Ca)2.2 and K(Ca)3.1. Toxins (Basel). 2023 Jan 5;15(1):41. doi: 10.3390/toxins15010041.
Ref 16 Cobatoxin 1 from Centruroides noxius scorpion venom: chemical synthesis, three-dimensional structure in solution, pharmacology and docking on K+ channels. Biochem J. 2004 Jan 1;377(Pt 1):37-49. doi: 10.1042/BJ20030977.
Ref 17 Targeting effector memory T cells with a selective peptide inhibitor of Kv1.3 channels for therapy of autoimmune diseases. Mol Pharmacol. 2005 Apr;67(4):1369-81. doi: 10.1124/mol.104.008193. Epub 2005 Jan 21.
Ref 18 Structural conservation of the pores of calcium-activated and voltage-gated potassium channels determined by a sea anemone toxin. J Biol Chem. 1999 Jul 30;274(31):21885-92. doi: 10.1074/jbc.274.31.21885.
Ref 19 Role of disulfide bonds in the structure and potassium channel blocking activity of ShK toxin. Biochemistry. 1999 Nov 2;38(44):14549-58. doi: 10.1021/bi991282m.
Ref 20 Engineering a stable and selective peptide blocker of the Kv1.3 channel in T lymphocytes. Mol Pharmacol. 2009 Apr;75(4):762-73. doi: 10.1124/mol.108.052704. Epub 2009 Jan 2.
Ref 21 N-Terminally extended analogues of the K? channel toxin from Stichodactyla helianthus as potent and selective blockers of the voltage-gated potassium channel Kv1.3. FEBS J. 2015 Jun;282(12):2247-59. doi: 10.1111/febs.13294. Epub 2015 Apr 23.
Ref 22 Toxin acidic residue evolutionary function-guided design of de novo peptide drugs for the immunotherapeutic target, the Kv1.3 channel. Sci Rep. 2015 May 8;5:9881. doi: 10.1038/srep09881.
Ref 23 Pharmacological profiling of Orthochirus scrobiculosus toxin 1 analogs with a trimmed N-terminal domain. Mol Pharmacol. 2006 Jan;69(1):354-62. doi: 10.1124/mol.105.017210. Epub 2005 Oct 18.
Ref 24 An engineered scorpion toxin analogue with improved Kv1.3 selectivity displays reduced conformational flexibility. Sci Rep. 2015 Dec 22;5:18397. doi: 10.1038/srep18397.
Ref 25 Maurotoxin: a potent inhibitor of intermediate conductance Ca2+-activated potassium channels. Mol Pharmacol. 2003 Feb;63(2):409-18. doi: 10.1124/mol.63.2.409.
Ref 26 A Fluorescent Peptide Toxin for Selective Visualization of the Voltage-Gated Potassium Channel K(V)1.3. Bioconjug Chem. 2022 Nov 16;33(11):2197-2212. doi: 10.1021/acs.bioconjchem.2c00436. Epub 2022 Nov 4.
Ref 27 Tst26, a novel peptide blocker of Kv1.2 and Kv1.3 channels from the venom of Tityus stigmurus. Toxicon. 2009 Sep 15;54(4):379-89. doi: 10.1016/j.toxicon.2009.05.023. Epub 2009 Jun 3.
Ref 28 Cm28, a scorpion toxin having a unique primary structure, inhibits KV1.2 and KV1.3 with high affinity. J Gen Physiol. 2022 Aug 1;154(8):e202213146. doi: 10.1085/jgp.202213146. Epub 2022 Jun 14.
Ref 29 Synthesis, folding, structure and activity of a predicted peptide from the sea anemone Oulactis sp. with an ShKT fold. Toxicon. 2018 Aug;150:50-59. doi: 10.1016/j.toxicon.2018.05.006. Epub 2018 May 19.
Ref 30 Isolation, chemical and functional characterization of several new K(+)-channel blocking peptides from the venom of the scorpion Centruroides tecomanus. Toxicon. 2016 Jun 1;115:1-12. doi: 10.1016/j.toxicon.2016.02.017. Epub 2016 Feb 26.
Ref 31 Vm23 and vm24, two scorpion peptides that block human t-lymphocyte potassium channels (sub-type kv1.3) with high selectivity and decrease the in vivo dth-responses in rats.
Ref 32 Anuroctoxin, a new scorpion toxin of the alpha-KTx 6 subfamily, is highly selective for Kv1.3 over IKCa1 ion channels of human T lymphocytes. Mol Pharmacol. 2005 Apr;67(4):1034-44. doi: 10.1124/mol.104.007187. Epub 2004 Dec 22.
Ref 33 An ERG channel inhibitor from the scorpion Buthus eupeus. J Biol Chem. 2001 Mar 30;276(13):9868-76. doi: 10.1074/jbc.M005973200. Epub 2001 Jan 2.
Ref 34 M-type K+ current inhibition by a toxin fron the scorpion Buthus eupeus. FEBS Lett. 1996 Apr 22;384(3):277-80. doi: 10.1016/0014-5793(96)00333-x.
Ref 35 BeKm-1 is a HERG-specific toxin that shares the structure with ChTx but the mechanism of action with ErgTx1. Biophys J. 2003 May;84(5):3022-36. doi: 10.1016/S0006-3495(03)70028-9.
Ref 36 Preferential closed channel blockade of HERG potassium currents by chemically synthesised BeKm-1 scorpion toxin. FEBS Lett. 2003 Jul 17;547(1-3):20-6. doi: 10.1016/s0014-5793(03)00662-8.
Ref 37 Unique interaction of scorpion toxins with the hERG channel. J Mol Recognit. 2004 May-Jun;17(3):209-17. doi: 10.1002/jmr.667.
Ref 38 Species diversity and peptide toxins blocking selectivity of ether-a-go-go-related gene subfamily K+ channels in the central nervous system. Mol Pharmacol. 2006 May;69(5):1673-83. doi: 10.1124/mol.105.019729. Epub 2006 Feb 23.
Ref 39 BeKm-1, a peptide inhibitor of human ether-a-go-go-related gene potassium currents, prolongs QTc intervals in isolated rabbit heart. J Pharmacol Exp Ther. 2011 Apr;337(1):2-8. doi: 10.1124/jpet.110.176883. Epub 2010 Dec 23.
Ref 40 A large number of novel Ergtoxin-like genes and ERG K+-channels blocking peptides from scorpions of the genus Centruroides. FEBS Lett. 2002 Dec 4;532(1-2):121-6. doi: 10.1016/s0014-5793(02)03652-9.
Ref 41 Interaction simulation of hERG K+ channel with its specific BeKm-1 peptide: insights into the selectivity of molecular recognition. J Proteome Res. 2007 Feb;6(2):611-20. doi: 10.1021/pr060368g.
Ref 42 New binding site on common molecular scaffold provides HERG channel specificity of scorpion toxin BeKm-1. J Biol Chem. 2002 Nov 8;277(45):43104-9. doi: 10.1074/jbc.M204083200. Epub 2002 Jul 31.
Ref 43 The precursors of the bee venom constituents apamin and MCD peptide are encoded by two genes in tandem which share the same 3'-exon. J Biol Chem. 1995 May 26;270(21):12704-8. doi: 10.1074/jbc.270.21.12704.
Ref 44 The peptide components of bee venom. Eur J Biochem. 1976 Jan 15;61(2):369-76. doi: 10.1111/j.1432-1033.1976.tb10030.x.
Ref 45 Apamin as a selective blocker of the calcium-dependent potassium channel in neuroblastoma cells: voltage-clamp and biochemical characterization of the toxin receptor. Proc Natl Acad Sci U S A. 1982 Feb;79(4):1308-12. doi: 10.1073/pnas.79.4.1308.
Ref 46 Apamin, a blocker of the calcium-activated potassium channel, induces neurodegeneration of Purkinje cells exclusively. Brain Res. 1997 Dec 19;778(2):405-8. doi: 10.1016/s0006-8993(97)01165-7.
Ref 47 Determinants of apamin and d-tubocurarine block in SK potassium channels. J Biol Chem. 1997 Sep 12;272(37):23195-200. doi: 10.1074/jbc.272.37.23195.
Ref 48 Pharmacological characterization of small-conductance Ca(2+)-activated K(+) channels stably expressed in HEK 293 cells. Br J Pharmacol. 2000 Mar;129(5):991-9. doi: 10.1038/sj.bjp.0703120.
Ref 49 SK3 is an important component of K(+) channels mediating the afterhyperpolarization in cultured rat SCG neurones. J Physiol. 2001 Sep 1;535(Pt 2):323-34. doi: 10.1111/j.1469-7793.2001.00323.x.
Ref 50 Apamin interacts with all subtypes of cloned small-conductance Ca2+-activated K+ channels. Pflugers Arch. 2001 Jan;441(4):544-50. doi: 10.1007/s004240000447.
Ref 51 An amino acid outside the pore region influences apamin sensitivity in small conductance Ca2+-activated K+ channels. J Biol Chem. 2007 Feb 9;282(6):3478-86. doi: 10.1074/jbc.M607213200. Epub 2006 Dec 1.
Ref 52 Apamin reduces neuromuscular transmission by activating inhibitory muscarinic M(2) receptors on motor nerve terminals. Eur J Pharmacol. 2010 Jan 25;626(2-3):239-43. doi: 10.1016/j.ejphar.2009.09.064. Epub 2009 Oct 8.
Ref 53 Allosteric block of KCa2 channels by apamin. J Biol Chem. 2010 Aug 27;285(35):27067-27077. doi: 10.1074/jbc.M110.110072. Epub 2010 Jun 18.
Ref 54 The small neurotoxin apamin blocks not only small conductance Ca(2+) activated K(+) channels (SK type) but also the voltage dependent Kv1.3 channel. Eur Biophys J. 2017 Sep;46(6):517-523. doi: 10.1007/s00249-016-1196-0. Epub 2017 Jan 20.
Ref 55 Apamin inhibits TNF-- and IFN--induced inflammatory cytokines and chemokines via suppressions of NF-B signaling pathway and STAT in human keratinocytes. Pharmacol Rep. 2017 Oct;69(5):1030-1035. doi: 10.1016/j.pharep.2017.04.006. Epub 2017 Apr 18.
Ref 56 Apamin Suppresses LPS-Induced Neuroinflammatory Responses by Regulating SK Channels and TLR4-Mediated Signaling Pathways. Int J Mol Sci. 2020 Jun 17;21(12):4319. doi: 10.3390/ijms21124319.
Ref 57 Apamin from bee venom suppresses inflammation in a murine model of gouty arthritis. J Ethnopharmacol. 2020 Jul 15;257:112860. doi: 10.1016/j.jep.2020.112860. Epub 2020 Apr 11.
Ref 58 Antioxidative, Antiapoptotic, and Anti-Inflammatory Effects of Apamin in a Murine Model of Lipopolysaccharide-Induced Acute Kidney Injury. Molecules. 2020 Dec 3;25(23):5717. doi: 10.3390/molecules25235717.
Ref 59 Solution structure of apamin determined by nuclear magnetic resonance and distance geometry. Biochemistry. 1988 Nov 1;27(22):8491-8. doi: 10.1021/bi00422a029.
Ref 60 Binding and toxicity of apamin. Characterization of the active site. Eur J Biochem. 1991 Mar 28;196(3):639-45. doi: 10.1111/j.1432-1033.1991.tb15860.x.
Ref 61 sVmKTx, a transcriptome analysis-based synthetic peptide analogue of Vm24, inhibits Kv1.3 channels of human T cells with improved selectivity. Biochem Pharmacol. 2022 May;199:115023. doi: 10.1016/j.bcp.2022.115023. Epub 2022 Mar 28.
Ref 62 Pharmacological characterization of human beta-defensins 3 and 4 on potassium channels: Evidence of diversity in beta-defensin-potassium channel interactions. Peptides. 2018 Oct;108:14-18. doi: 10.1016/j.peptides.2018.08.005. Epub 2018 Aug 16.
Ref 63 Tamapin, a venom peptide from the Indian red scorpion (Mesobuthus tamulus) that targets small conductance Ca2+-activated K+ channels and afterhyperpolarization currents in central neurons. J Biol Chem. 2002 Nov 29;277(48):46101-9. doi: 10.1074/jbc.M206465200. Epub 2002 Sep 17.
Ref 64 A selective blocker of Kv1.2 and Kv1.3 potassium channels from the venom of the scorpion Centruroides suffusus suffusus. Biochem Pharmacol. 2008 Oct 30;76(9):1142-54. doi: 10.1016/j.bcp.2008.08.018. Epub 2008 Aug 22.
Ref 65 Scorpion Potassium Channel-blocking Defensin Highlights a Functional Link with Neurotoxin. J Biol Chem. 2016 Mar 25;291(13):7097-106. doi: 10.1074/jbc.M115.680611. Epub 2016 Jan 27.
Ref 66 Human -defensins are immune-related Kv1.3 channel inhibitors: new support for their roles in adaptive immunity. FASEB J. 2015 Oct;29(10):4324-33. doi: 10.1096/fj.15-274787. Epub 2015 Jul 6.
Ref 67 Human beta-defensin 1, a new animal toxin-like blocker of potassium channel. Toxicon. 2016 Apr;113:1-6. doi: 10.1016/j.toxicon.2016.02.007. Epub 2016 Feb 5.
Ref 68 Plectasin, first animal toxin-like fungal defensin blocking potassium channels through recognizing channel pore region. Toxins (Basel). 2015 Jan 5;7(1):34-42. doi: 10.3390/toxins7010034.
Ref 69 The genome of Mesobuthus martensii reveals a unique adaptation model of arthropods. Nat Commun. 2013;4:2602. doi: 10.1038/ncomms3602.
Ref 70 Ion channel modulation by scorpion hemolymph and its defensin ingredients highlights origin of neurotoxins in telson formed in Paleozoic scorpions. Int J Biol Macromol. 2020 Apr 1;148:351-363. doi: 10.1016/j.ijbiomac.2020.01.133. Epub 2020 Jan 15.
Ref 71 Increasing the molecular contacts between maurotoxin and Kv1.2 channel augments ligand affinity. Proteins. 2005 Aug 15;60(3):401-11. doi: 10.1002/prot.20509.
Ref 72 Chemical synthesis and 1H-NMR 3D structure determination of AgTx2-MTX chimera, a new potential blocker for Kv1.2 channel, derived from MTX and AgTx2 scorpion toxins. Protein Sci. 2008 Jan;17(1):107-18. doi: 10.1110/ps.073122908. Epub 2007 Nov 27.
Ref 73 ShK-Dap22, a potent Kv1.3-specific immunosuppressive polypeptide. J Biol Chem. 1998 Dec 4;273(49):32697-707. doi: 10.1074/jbc.273.49.32697.
Ref 74 Structure, molecular modeling, and function of the novel potassium channel blocker urotoxin isolated from the venom of the Australian scorpion Urodacus yaschenkoi. Mol Pharmacol. 2014 Jul;86(1):28-41. doi: 10.1124/mol.113.090183. Epub 2014 Apr 10.
Ref 75 Structural basis of the potency and selectivity of Urotoxin, a potent Kv1 blocker from scorpion venom. Biochem Pharmacol. 2020 Apr;174:113782. doi: 10.1016/j.bcp.2019.113782. Epub 2019 Dec 25.
Ref 76 K+ channel types targeted by synthetic OSK1, a toxin from Orthochirus scrobiculosus scorpion venom. Biochem J. 2005 Jan 1;385(Pt 1):95-104. doi: 10.1042/BJ20041379.
Ref 77 The impact of the fourth disulfide bridge in scorpion toxins of the alpha-KTx6 subfamily. Proteins. 2005 Dec 1;61(4):1010-23. doi: 10.1002/prot.20681.
Ref 78 Evidence for domain-specific recognition of SK and Kv channels by MTX and HsTx1 scorpion toxins. J Biol Chem. 2004 Dec 31;279(53):55690-6. doi: 10.1074/jbc.M410055200. Epub 2004 Oct 21.
Ref 79 Pharmaceutical Optimization of Peptide Toxins for Ion Channel Targets: Potent, Selective, and Long-Lived Antagonists of Kv1.3. J Med Chem. 2015 Sep 10;58(17):6784-802. doi: 10.1021/acs.jmedchem.5b00495. Epub 2015 Aug 31.
Ref 80 Design and characterization of a highly selective peptide inhibitor of the small conductance calcium-activated K+ channel, SkCa2. J Biol Chem. 2001 Nov 16;276(46):43145-51. doi: 10.1074/jbc.M106981200. Epub 2001 Aug 29.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.