General Information of This Target
Target ID
BTDT00052
Target Name
Potassium voltage-gated channel subfamily B member 1 (Kcnb1)
Target Bioclass
Transporter and channel
Uniprot ID
P15387
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
Kcnb1
Gene ID
25736
Synonym
Delayed rectifier potassium channel 1; Voltage-gated potassium channel subunit Kv2.1
Sequence
MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKL
RDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELD
YWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRKKLWDLLE
KPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQSTDNPQLAHVEAVCIAWF
TMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFR
IMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTK
FKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFY
KEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFARSIEMMDIVVEKNGESIAKKDKVQD
NHLSPNKWKWTKRALSETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLEDMYSKMAKTQ
SQPILNTKEMAPQSKPPEELEMSSMPSPVAPLPARTEGVIDMRSMSSIDSFISCATDFPE
ATRFSHSPLASLSSKAGSSTAPEVGWRGALGASGGRLTETNPIPETSRSGFFVESPRSSM
KTNNPLKLRALKVNFVEGDPTPLLPSLGLYHDPLRNRGGAAAAVAGLECASLLDKPVLSP
ESSIYTTASARTPPRSPEKHTAIAFNFEAGVHHYIDTDTDDEGQLLYSVDSSPPKSLHGS
TSPKFSTGARTEKNHFESSPLPTSPKFLRPNCVYSSEGLTGKGPGAQEKCKLENHTPPDV
HMLPGGGAHGSTRDQSI

    Click to Show/Hide
Family
the potassium channel family
Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain, but also in the pancreas and cardiovascular system. Contributes to the regulation of the action potential (AP) repolarization, duration and frequency of repetitive AP firing in neurons, muscle cells and endocrine cells and plays a role in homeostatic attenuation of electrical excitability throughout the brain. Also plays a role in the regulation of exocytosis independently of its electrical function. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Homotetrameric channels mediate a delayed-rectifier voltage-dependent outward potassium current that display rapid activation and slow inactivation in response to membrane depolarization. Can form functional homotetrameric and heterotetrameric channels that contain variable proportions of KCNB2; channel properties depend on the type of alpha subunits that are part of the channel. Can also form functional heterotetrameric channels with other alpha subunits that are non- conducting when expressed alone, such as KCNF1, KCNG1, KCNG3, KCNG4, KCNH1, KCNH2, KCNS1, KCNS2, KCNS3 and KCNV1, creating a functionally diverse range of channel complexes. Heterotetrameric channel activity formed with KCNS3 show increased current amplitude with the threshold for action potential activation shifted towards more negative values in hypoxic-treated pulmonary artery smooth muscle cells. Channel properties are also modulated by cytoplasmic ancillary beta subunits such as AMIGO1, KCNE1, KCNE2 and KCNE3, slowing activation and inactivation rate of the delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Major contributor to the slowly inactivating delayed- rectifier voltage-gated potassium current in neurons of the central nervous system, sympathetic ganglion neurons, neuroendocrine cells, pancreatic beta cells, cardiomyocytes and smooth muscle cells. Mediates the major part of the somatodendritic delayed-rectifier potassium current in hippocampal and cortical pyramidal neurons and sympathetic superior cervical ganglion (CGC) neurons that acts to slow down periods of firing, especially during high frequency stimulation. Plays a role in the induction of long-term potentiation (LTP) of neuron excitability in the CA3 layer of the hippocampus. Contributes to the regulation of glucose- induced action potential amplitude and duration in pancreatic beta cells, hence limiting calcium influx and insulin secretion. Plays a role in the regulation of resting membrane potential and contraction in hypoxia-treated pulmonary artery smooth muscle cells. May contribute to the regulation of the duration of both the action potential of cardiomyocytes and the heart ventricular repolarization QT interval. Contributes to the pronounced pro-apoptotic potassium current surge during neuronal apoptotic cell death in response to oxidative injury. May confer neuroprotection in response to hypoxia/ischemic insults by suppressing pyramidal neurons hyperexcitability in hippocampal and cortical regions. Promotes trafficking of KCNG3, KCNH1 and KCNH2 to the cell surface membrane, presumably by forming heterotetrameric channels with these subunits. Plays a role in the calcium-dependent recruitment and release of fusion-competent vesicles from the soma of neurons, neuroendocrine and glucose-induced pancreatic beta cells by binding key components of the fusion machinery in a pore- independent manner.

    Click to Show/Hide
Taxonomy ID
10116
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Rodentia
Family: Muridae
Genus: Rattus
Species: Rattus norvegicus
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    GxTx1E (K15[CAcm],M35[Nle]) . . [1]
 Toxin Info    GxTx1E (K21[CAcm],M35[Nle]) . . [1]
 Toxin Info    GxTx1E (K27[CAcm],M35[Nle]) . . [1]
 Toxin Info    GxTx1E (N32[CAcm],M35[Nle]) . . [1]
 Toxin Info    GxTx1E (S13[CAcm],M35[Nle]) . . [1]
 Toxin Info    N.vectensis toxin 4 Effect . [2]
 Toxin Info    N.vectensis toxin 5 Effect . [2]
 Toxin Info    Potassium channel toxin alpha-KTx 23.1 Inhibition rate . [3]
 Toxin Info    Mu-theraphotoxin-Pn3a Inhibition rate . [4- 9]
 Toxin Info    Beta/kappa-theraphotoxin-Gi1a Inhibition rate . [10]
 Toxin Info    Crotamine Inhibition rate . [11]
 Toxin Info    Kappa-actitoxin-Bcs3a Inhibition rate . [12]
 Toxin Info    Defensin-like protein 1 Inhibition rate . [13]
 Toxin Info    Kappa-actitoxin-Bcs3b Inhibition rate . [12]
 Toxin Info    Kunitz-type conkunitzin-S1 Inhibition rate . [14], [15], [16]
 Toxin Info    Mu-conotoxin GIIIA Inhibition rate . [17- 29]
 Toxin Info    Mu-conotoxin PIIIA Inhibition rate . [18- 34]
 Toxin Info    Mu-conotoxin SIIIA Inhibition rate . [25- 59]
 Toxin Info    Potassium channel toxin alpha-KTx 1.17 Inhibition rate . [60]
 Toxin Info    Potassium channel toxin alpha-KTx 19.2 Inhibition rate . [61]
 Toxin Info    Toxin PhcrTx2 Inhibition rate . [62]
 Toxin Info    Potassium channel toxin alpha-KTx 1.1 Inhibition rate . [63]
 Toxin Info    Potassium channel toxin alpha-KTx 1.16 Inhibition rate . [60]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 Inhibition rate . [64]
 Toxin Info    Potassium channel toxin alpha-KTx 8.8 Inhibition rate . [65]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.1 Inhibition rate . [66]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.2 Inhibition rate . [66]
 Toxin Info    U-Asilidin(12)-Dg3b Inhibition rate . [67], [68]
 Toxin Info    Kappa-LhTx-1 Inhibition rate . [69]
 Toxin Info    Kappa-actitoxin-Bcs4a Inhibition rate . [70]
 Toxin Info    Potassium channel toxin kappa-KTx 2.5 Inhibition rate . [71]
 Toxin Info    Potassium channel toxin TsTXK-beta Inhibition rate . [72]
 Toxin Info    Thrombin-like enzyme collinein-1 Inhibition rate . [73], [74], [75], [76]
 Toxin Info    U-actitoxin-Oulsp1 Inhibition rate . [77]
 Toxin Info    Potassium channel toxin AbeTx1 Inhibition rate . [78]
 Toxin Info    Potassium channel toxin AbeTx1 Inhibition rate . [78]
 Toxin Info    Potassium channel toxin alpha-KTx 12.2 Inhibition rate . [64]
 Toxin Info    Mu-theraphotoxin-Pspp1 Inhibition rate . [7]
 Toxin Info    Kappa-actitoxin-Ate1a Inhibition rate . [79]
 Toxin Info    Potassium channel toxin alpha-KTx 23.1 Inhibition rate . [3- 80]
 Toxin Info    Toxin VmKTx1 Inhibition rate . [81]
 Toxin Info    Potassium channel toxin alpha-KTx 3.4 Inhibition rate . [63]
 Toxin Info    Potassium channel toxin alpha-KTx 3.2 Inhibition rate . [63]
 Toxin Info    Potassium channel toxin alpha-KTx 12.1 Inhibition rate . [64]
 Toxin Info    Potassium channel toxin alpha-KTx 2.13 Inhibition rate . [82]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 Inhibition rate . [83]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 Inhibition rate . [83- 87]
 Toxin Info    KappaPI-actitoxin-Ael3a Inhibition rate . [88], [89]
 Toxin Info    Potassium channel toxin alpha-KTx 6.12 Inhibition rate
20 %
[90]
References
Ref 1 Chemoselective tarantula toxins report voltage activation of wild-type ion channels in live cells. Proc Natl Acad Sci U S A. 2014 Nov 4;111(44):E4789-96. doi: 10.1073/pnas.1406876111. Epub 2014 Oct 20.
Ref 2 The Birth and Death of Toxins with Distinct Functions: A Case Study in the Sea Anemone Nematostella. Mol Biol Evol. 2019 Sep 1;36(9):2001-2012. doi: 10.1093/molbev/msz132.
Ref 3 Vm24, a natural immunosuppressive peptide, potently and selectively blocks Kv1.3 potassium channels of human T cells. Mol Pharmacol. 2012 Sep;82(3):372-82. doi: 10.1124/mol.112.078006. Epub 2012 May 23.
Ref 4 Pharmacological characterisation of the highly Na(V)1.7 selective spider venom peptide Pn3a. Sci Rep. 2017 Jan 20;7:40883. doi: 10.1038/srep40883.
Ref 5 Corrigendum: Pharmacological characterisation of the highly Na(V)1.7 selective spider venom peptide Pn3a. Sci Rep. 2017 May 26;7:46816. doi: 10.1038/srep46816.
Ref 6 Antiallodynic effects of the selective NaV1.7 inhibitor Pn3a in a mouse model of acute postsurgical pain: evidence for analgesic synergy with opioids and baclofen. Pain. 2019 Aug;160(8):1766-1780. doi: 10.1097/j.pain.0000000000001567.
Ref 7 Chemical Synthesis, Proper Folding, Na(v) Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. doi: 10.3390/toxins11060367.
Ref 8 Spider Venom Peptide Pn3a Inhibition of Primary Afferent High Voltage-Activated Calcium Channels. Front Pharmacol. 2021 Jan 28;11:633679. doi: 10.3389/fphar.2020.633679. eCollection 2020.
Ref 9 -Theraphotoxin Pn3a inhibition of Ca(V)3.3 channels reveals a novel isoform-selective drug binding site. Elife. 2022 Jul 20;11:e74040. doi: 10.7554/eLife.74040.
Ref 10 GiTx1(/-theraphotoxin-Gi1a), a novel toxin from the venom of Brazilian tarantula Grammostola iheringi (Mygalomorphae, Theraphosidae): Isolation, structural assessments and activity on voltage-gated ion channels. Biochimie. 2020 Sep;176:138-149. doi: 10.1016/j.biochi.2020.07.008. Epub 2020 Jul 24.
Ref 11 Crotamine pharmacology revisited: novel insights based on the inhibition of KV channels. Mol Pharmacol. 2012 Jul;82(1):90-6. doi: 10.1124/mol.112.078188. Epub 2012 Apr 12.
Ref 12 Biochemical and electrophysiological characterization of two sea anemone type 1 potassium toxins from a geographically distant population of Bunodosoma caissarum. Mar Drugs. 2013 Mar 6;11(3):655-79. doi: 10.3390/md11030655.
Ref 13 The antifungal plant defensin AtPDF2.3 from Arabidopsis thaliana blocks potassium channels. Sci Rep. 2016 Aug 30;6:32121. doi: 10.1038/srep32121.
Ref 14 Production of recombinant Conkunitzin-S1 in Escherichia coli. Protein Expr Purif. 2006 Jun;47(2):640-4. doi: 10.1016/j.pep.2006.01.019. Epub 2006 Feb 20.
Ref 15 Conkunitzin-S1 is the first member of a new Kunitz-type neurotoxin family. Structural and functional characterization. J Biol Chem. 2005 Jun 24;280(25):23766-70. doi: 10.1074/jbc.C500064200. Epub 2005 Apr 15.
Ref 16 Structure of conkunitzin-S1, a neurotoxin and Kunitz-fold disulfide variant from cone snail. Acta Crystallogr D Biol Crystallogr. 2006 Sep;62(Pt 9):980-90. doi: 10.1107/S0907444906021123. Epub 2006 Aug 19.
Ref 17 Evolution of separate predation- and defence-evoked venoms in carnivorous cone snails. Nat Commun. 2014 Mar 24;5:3521. doi: 10.1038/ncomms4521.
Ref 18 Definition of the M-conotoxin superfamily: characterization of novel peptides from molluscivorous Conus venoms. Biochemistry. 2005 Jun 7;44(22):8176-86. doi: 10.1021/bi047541b.
Ref 19 The amino acid sequences of homologous hydroxyproline-containing myotoxins from the marine snail Conus geographus venom. FEBS Lett. 1983 May 8;155(2):277-80. doi: 10.1016/0014-5793(82)80620-0.
Ref 20 Disulfide pairings in geographutoxin I, a peptide neurotoxin from Conus geographus. FEBS Lett. 1990 May 7;264(1):29-32. doi: 10.1016/0014-5793(90)80756-9.
Ref 21 Action of derivatives of mu-conotoxin GIIIA on sodium channels. Single amino acid substitutions in the toxin separately affect association and dissociation rates. Biochemistry. 1992 Sep 8;31(35):8229-38. doi: 10.1021/bi00150a016.
Ref 22 Distinction among neuronal subtypes of voltage-activated sodium channels by mu-conotoxin PIIIA. J Neurosci. 2000 Jan 1;20(1):76-80. doi: 10.1523/JNEUROSCI.20-01-00076.2000.
Ref 23 Role of hydroxyprolines in the in vitro oxidative folding and biological activity of conotoxins. Biochemistry. 2008 Feb 12;47(6):1741-51. doi: 10.1021/bi701934m. Epub 2008 Jan 12.
Ref 24 Pruning nature: Biodiversity-derived discovery of novel sodium channel blocking conotoxins from Conus bullatus. Toxicon. 2009 Jan;53(1):90-8. doi: 10.1016/j.toxicon.2008.10.017. Epub 2008 Nov 20.
Ref 25 -Conotoxins that differentially block sodium channels NaV1.1 through 1.8 identify those responsible for action potentials in sciatic nerve. Proc Natl Acad Sci U S A. 2011 Jun 21;108(25):10302-7. doi: 10.1073/pnas.1107027108. Epub 2011 Jun 7.
Ref 26 NMR Structure of -Conotoxin GIIIC: Leucine 18 Induces Local Repacking of the N-Terminus Resulting in Reduced Na(V) Channel Potency. Molecules. 2018 Oct 22;23(10):2715. doi: 10.3390/molecules23102715.
Ref 27 Solution structure of mu-conotoxin GIIIA analysed by 2D-NMR and distance geometry calculations. FEBS Lett. 1991 Jan 28;278(2):160-6. doi: 10.1016/0014-5793(91)80107-e.
Ref 28 Tertiary structure of conotoxin GIIIA in aqueous solution. Biochemistry. 1991 Jul 16;30(28):6908-16. doi: 10.1021/bi00242a014.
Ref 29 Structure-activity relationships of mu-conotoxin GIIIA: structure determination of active and inactive sodium channel blocker peptides by NMR and simulated annealing calculations. Biochemistry. 1992 Dec 22;31(50):12577-84. doi: 10.1021/bi00165a006.
Ref 30 mu-Conotoxin PIIIA, a new peptide for discriminating among tetrodotoxin-sensitive Na channel subtypes. J Neurosci. 1998 Jun 15;18(12):4473-81. doi: 10.1523/JNEUROSCI.18-12-04473.1998.
Ref 31 A novel -conopeptide, CnIIIC, exerts potent and preferential inhibition of NaV1.2/1.4 channels and blocks neuronal nicotinic acetylcholine receptors. Br J Pharmacol. 2012 Jul;166(5):1654-68. doi: 10.1111/j.1476-5381.2012.01837.x.
Ref 32 Co-expression of Na(V) subunits alters the kinetics of inhibition of voltage-gated sodium channels by pore-blocking -conotoxins. Br J Pharmacol. 2013 Apr;168(7):1597-610. doi: 10.1111/bph.12051.
Ref 33 Structurally diverse -conotoxin PIIIA isomers block sodium channel NaV 1.4. Angew Chem Int Ed Engl. 2012 Apr 23;51(17):4058-61. doi: 10.1002/anie.201107011. Epub 2012 Mar 12.
Ref 34 Solution structure of mu-conotoxin PIIIA, a preferential inhibitor of persistent tetrodotoxin-sensitive sodium channels. J Biol Chem. 2002 Jul 26;277(30):27247-55. doi: 10.1074/jbc.M201611200. Epub 2002 May 2.
Ref 35 A novel conotoxin from Conus striatus, mu-SIIIA, selectively blocking rat tetrodotoxin-resistant sodium channels. Toxicon. 2006 Jan;47(1):122-32. doi: 10.1016/j.toxicon.2005.10.008. Epub 2005 Dec 1.
Ref 36 Novel conotoxins from Conus striatus and Conus kinoshitai selectively block TTX-resistant sodium channels. Biochemistry. 2005 May 17;44(19):7259-65. doi: 10.1021/bi0473408.
Ref 37 A Lewis Acid-Controlled Enantiodivergent Epoxidation of Aldehydes. ACS Catal. 2023 Oct 6;13(19):13117-13126. doi: 10.1021/acscatal.3c03929. Epub 2023 Sep 25.
Ref 38 Retraction of "Effect of Fluoride Layer Growth on the Deposition Rate under Different Microchannel Structures". ACS Omega. 2024 Feb 28;9(10):12291. doi: 10.1021/acsomega.4c01652. eCollection 2024 Mar 12.
Ref 39 Retraction of "Assessing the Weathering Performance and Functionality of Nanoparticle-Enhanced High-Pressure Laminates for Building Facade Applications". ACS Omega. 2024 Mar 1;9(10):12290. doi: 10.1021/acsomega.4c01411. eCollection 2024 Mar 12.
Ref 40 Correction to "Digoxin-Mediated Inhibition of Potential Hypoxia-Related Angiogenic Repair in Modulated Electro-Hyperthermia (mEHT)-Treated Murine Triple-Negative Breast Cancer Model". ACS Pharmacol Transl Sci. 2024 Feb 28;7(3):904. doi: 10.1021/acsptsci.4c00094. eCollection 2024 Mar 8.
Ref 41 Correction to 1,2,3-Triazole Tethered Hybrid Capsaicinoids as Antiproliferative Agents Active against Lung Cancer Cells (A549). ACS Omega. 2024 Feb 20;9(9):11026. doi: 10.1021/acsomega.4c00155. eCollection 2024 Mar 5.
Ref 42 Correction to "Dual-Surfactant-Capped Ag Nanoparticles as a Highly Selective and Sensitive Colorimetric Sensor for Citrate Detection". ACS Omega. 2024 Feb 22;9(9):11025. doi: 10.1021/acsomega.3c09929. eCollection 2024 Mar 5.
Ref 43 Colloidal Stability of PFSA-Ionomer Dispersions. Part I. Single-Ion Electrostatic Interaction Potential Energies. Langmuir. 2024 Apr 2;40(13):6654-6665. doi: 10.1021/acs.langmuir.3c03903. Epub 2024 Mar 8.
Ref 44 Correction to "Searching for the Rules of Electrochemical Nitrogen Fixation". ACS Catal. 2024 Feb 14;14(5):3169-3170. doi: 10.1021/acscatal.4c00448. eCollection 2024 Mar 1.
Ref 45 Correction to "Quantification and Mapping of Alkylation in the Human Genome Reveal Single Nucleotide Resolution Precursors of Mutational Signatures". ACS Cent Sci. 2024 Jan 25;10(2):487. doi: 10.1021/acscentsci.3c01597. eCollection 2024 Feb 28.
Ref 46 Correction to "Characterization of Proteins Extracted from Ulva sp., Padina sp., and Laurencia sp. Macroalgae Using Green Technology: Effect of In Vitro Digestion on Antioxidant and ACE-I Inhibitory Activity". ACS Omega. 2024 Feb 16;9(8):9848. doi: 10.1021/acsomega.4c00407. eCollection 2024 Feb 27.
Ref 47 Erratum: Antibacterial Efficacy of ZnO/Bentonite (Clay) Nanocomposites against Multidrug-Resistant Escherichia coli. ACS Omega. 2024 Feb 15;9(8):9847. doi: 10.1021/acsomega.4c00630. eCollection 2024 Feb 27.
Ref 48 Low-Cost Nonfused-Ring Electron Acceptors Enabled by Noncovalent Conformational Locks. Acc Chem Res. 2024 Mar 19;57(6):981-991. doi: 10.1021/acs.accounts.3c00813. Epub 2024 Mar 3.
Ref 49 Retraction of "Hydrogenolysis of Polyethylene and Polypropylene into Propane over Cobalt-Based Catalysts". JACS Au. 2024 Feb 7;4(2):865. doi: 10.1021/jacsau.4c00090. eCollection 2024 Feb 26.
Ref 50 Correction to "Comprehensive Study of Preparation of Carboxy Group-Containing Cellulose Fibers from Dry-Lap Kraft Pulps by Catalytic Oxidation with Solid NaOCl". ACS Sustain Chem Eng. 2024 Feb 6;12(7):2921-2923. doi: 10.1021/acssuschemeng.4c00215. eCollection 2024 Feb 19.
Ref 51 Correction to "Dissolution Behavior of Polycyclic Aromatic Hydrocarbons in Heavy Oil in the Presence of Supercritical Cyclohexane". ACS Omega. 2024 Jan 31;9(6):7269. doi: 10.1021/acsomega.4c00064. eCollection 2024 Feb 13.
Ref 52 Retraction of "Fe(3)O(4) Nanoparticles Grown on Cellulose/GO Hydrogels as Advanced Catalytic Materials for the Heterogeneous Fenton-like Reaction". ACS Omega. 2024 Jan 31;9(6):7270. doi: 10.1021/acsomega.4c00561. eCollection 2024 Feb 13.
Ref 53 Correction to "Ligand Chromophore Modification Approach for Predictive Incremental Tuning of Metal-Organic Framework Color". Chem Mater. 2024 Jan 19;36(3):1773. doi: 10.1021/acs.chemmater.3c03160. eCollection 2024 Feb 13.
Ref 54 Correction to "Electrospun Nanofibrous UV Filters with Bidirectional Actuation Properties Based on Salmon Sperm DNA/Silk Fibroin for Biomedical Applications". ACS Omega. 2024 Jan 25;9(5):6025. doi: 10.1021/acsomega.4c00072. eCollection 2024 Feb 6.
Ref 55 Correction to "Iterative Dual-Metal and Energy Transfer Catalysis Enables Stereodivergence in Alkyne Difunctionalization: Carboboration as Case Study". ACS Catal. 2024 Jan 22;14(3):1976. doi: 10.1021/acscatal.4c00200. eCollection 2024 Feb 2.
Ref 56 Correction to "Nanotechnology Impact on Chemical-Enhanced Oil Recovery: A Review and Bibliometric Analysis of Recent Developments". ACS Omega. 2024 Jan 15;9(4):5083. doi: 10.1021/acsomega.3c10450. eCollection 2024 Jan 30.
Ref 57 Neuronally micro-conotoxins from Conus striatus utilize an alpha-helical motif to target mammalian sodium channels. J Biol Chem. 2008 Aug 1;283(31):21621-8. doi: 10.1074/jbc.M802852200. Epub 2008 Jun 3.
Ref 58 N- and C-terminal extensions of -conotoxins increase potency and selectivity for neuronal sodium channels. Biopolymers. 2012;98(2):161-5. doi: 10.1002/bip.22032. Epub 2012 Feb 10.
Ref 59 Structure, dynamics, and selectivity of the sodium channel blocker mu-conotoxin SIIIA. Biochemistry. 2008 Oct 14;47(41):10940-9. doi: 10.1021/bi801010u. Epub 2008 Sep 18.
Ref 60 K(V)1.2 channel-specific blocker from Mesobuthus eupeus scorpion venom: Structural basis of selectivity. Neuropharmacology. 2018 Dec;143:228-238. doi: 10.1016/j.neuropharm.2018.09.030. Epub 2018 Sep 22.
Ref 61 Characterization of Kbot21 Reveals Novel Side Chain Interactions of Scorpion Toxins Inhibiting Voltage-Gated Potassium Channels. PLoS One. 2015 Sep 23;10(9):e0137611. doi: 10.1371/journal.pone.0137611. eCollection 2015.
Ref 62 PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer. Toxins (Basel). 2018 Feb 7;10(2):72. doi: 10.3390/toxins10020072.
Ref 63 Purification and characterization of three inhibitors of voltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom. Biochemistry. 1994 Jun 7;33(22):6834-9. doi: 10.1021/bi00188a012.
Ref 64 Electrophysiological characterization of Ts6 and Ts7, K? channel toxins isolated through an improved Tityus serrulatus venom purification procedure. Toxins (Basel). 2014 Feb 28;6(3):892-913. doi: 10.3390/toxins6030892.
Ref 65 C-Terminal residues in small potassium channel blockers OdK1 and OSK3 from scorpion venom fine-tune the selectivity. Biochim Biophys Acta Proteins Proteom. 2017 May;1865(5):465-472. doi: 10.1016/j.bbapap.2017.02.001. Epub 2017 Feb 4.
Ref 66 Structural and Functional Elucidation of Peptide Ts11 Shows Evidence of a Novel Subfamily of Scorpion Venom Toxins. Toxins (Basel). 2016 Sep 30;8(10):288. doi: 10.3390/toxins8100288.
Ref 67 Buzz Kill: Function and Proteomic Composition of Venom from the Giant Assassin Fly Dolopus genitalis (Diptera: Asilidae). Toxins (Basel). 2018 Nov 5;10(11):456. doi: 10.3390/toxins10110456.
Ref 68 Weaponisation 'on the fly': Convergent recruitment of knottin and defensin peptide scaffolds into the venom of predatory assassin flies. Insect Biochem Mol Biol. 2020 Mar;118:103310. doi: 10.1016/j.ibmb.2019.103310. Epub 2019 Dec 21.
Ref 69 Variation of Two S3b Residues in K(V)4.1-4.3 Channels Underlies Their Different Modulations by Spider Toxin -LhTx-1. Front Pharmacol. 2021 Jun 10;12:692076. doi: 10.3389/fphar.2021.692076. eCollection 2021.
Ref 70 BcsTx3 is a founder of a novel sea anemone toxin family of potassium channel blocker. FEBS J. 2013 Oct;280(19):4839-52. doi: 10.1111/febs.12456. Epub 2013 Aug 23.
Ref 71 The new kappa-KTx 2.5 from the scorpion Opisthacanthus cayaporum. Peptides. 2011 Jul;32(7):1509-17. doi: 10.1016/j.peptides.2011.05.017. Epub 2011 May 23.
Ref 72 Ts8 scorpion toxin inhibits the Kv4.2 channel and produces nociception in?vivo. Toxicon. 2016 Sep 1;119:244-52. doi: 10.1016/j.toxicon.2016.06.014. Epub 2016 Jun 23.
Ref 73 Expression of a new serine protease from Crotalus durissus collilineatus venom in Pichia pastoris and functional comparison with the native enzyme. Appl Microbiol Biotechnol. 2015 Dec;99(23):9971-86. doi: 10.1007/s00253-015-6836-2. Epub 2015 Jul 31.
Ref 74 Functional and biological insights of rCollinein-1, a recombinant serine protease from Crotalus durissus collilineatus. J Venom Anim Toxins Incl Trop Dis. 2019 Apr 8;25:e147118. doi: 10.1590/1678-9199-JVATITD-1471-18. eCollection 2019.
Ref 75 Beyond hemostasis: a snake venom serine protease with potassium channel blocking and potential antitumor activities. Sci Rep. 2020 Mar 11;10(1):4476. doi: 10.1038/s41598-020-61258-x.
Ref 76 Towards toxin PEGylation: The example of rCollinein-1, a snake venom thrombin-like enzyme, as a PEGylated biopharmaceutical prototype. Int J Biol Macromol. 2021 Nov 1;190:564-573. doi: 10.1016/j.ijbiomac.2021.09.004. Epub 2021 Sep 7.
Ref 77 Sunanda, Punnepalli, et al. "Identification, chemical synthesis, structure, and function of a new KV1 channel blocking peptide from Oulactis sp." Peptide Science 110.4 (2018): e24073.
Ref 78 AbeTx1 Is a Novel Sea Anemone Toxin with a Dual Mechanism of Action on Shaker-Type K? Channels Activation. Mar Drugs. 2018 Oct 1;16(10):360. doi: 10.3390/md16100360.
Ref 79 PHAB toxins: a unique family of predatory sea anemone toxins evolving via intra-gene concerted evolution defines a new peptide fold. Cell Mol Life Sci. 2018 Dec;75(24):4511-4524. doi: 10.1007/s00018-018-2897-6. Epub 2018 Aug 14.
Ref 80 Structure, function, and chemical synthesis of Vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes. Biochemistry. 2012 May 15;51(19):4049-61. doi: 10.1021/bi300060n. Epub 2012 May 7.
Ref 81 sVmKTx, a transcriptome analysis-based synthetic peptide analogue of Vm24, inhibits Kv1.3 channels of human T cells with improved selectivity. Biochem Pharmacol. 2022 May;199:115023. doi: 10.1016/j.bcp.2022.115023. Epub 2022 Mar 28.
Ref 82 A selective blocker of Kv1.2 and Kv1.3 potassium channels from the venom of the scorpion Centruroides suffusus suffusus. Biochem Pharmacol. 2008 Oct 30;76(9):1142-54. doi: 10.1016/j.bcp.2008.08.018. Epub 2008 Aug 22.
Ref 83 Purification and characterization of Ts15, the first member of a new -KTX subfamily from the venom of the Brazilian scorpion Tityus serrulatus. Toxicon. 2011 Jul;58(1):54-61. doi: 10.1016/j.toxicon.2011.05.001. Epub 2011 May 13.
Ref 84 Proteomic endorsed transcriptomic profiles of venom glands from Tityus obscurus and T. serrulatus scorpions. PLoS One. 2018 Mar 21;13(3):e0193739. doi: 10.1371/journal.pone.0193739. eCollection 2018.
Ref 85 Novel components of Tityus serrulatus venom: A transcriptomic approach. Toxicon. 2021 Jan 15;189:91-104. doi: 10.1016/j.toxicon.2020.11.001. Epub 2020 Nov 10.
Ref 86 Moving pieces in a venomic puzzle: unveiling post-translationally modified toxins from Tityus serrulatus. J Proteome Res. 2013 Jul 5;12(7):3460-70. doi: 10.1021/pr4003068. Epub 2013 Jun 13.
Ref 87 Influence of post-starvation extraction time and prey-specific diet in Tityus serrulatus scorpion venom composition and hyaluronidase activity. Toxicon. 2014 Nov;90:326-36. doi: 10.1016/j.toxicon.2014.08.064. Epub 2014 Sep 6.
Ref 88 A bifunctional sea anemone peptide with Kunitz type protease and potassium channel inhibiting properties. Biochem Pharmacol. 2011 Jul 1;82(1):81-90. doi: 10.1016/j.bcp.2011.03.023. Epub 2011 Apr 6.
Ref 89 Development of a rational nomenclature for naming peptide and protein toxins from sea anemones. Toxicon. 2012 Sep 15;60(4):539-50. doi: 10.1016/j.toxicon.2012.05.020. Epub 2012 Jun 5.
Ref 90 Anuroctoxin, a new scorpion toxin of the alpha-KTx 6 subfamily, is highly selective for Kv1.3 over IKCa1 ion channels of human T lymphocytes. Mol Pharmacol. 2005 Apr;67(4):1034-44. doi: 10.1124/mol.104.007187. Epub 2004 Dec 22.
Ref 91 Design and characterization of a highly selective peptide inhibitor of the small conductance calcium-activated K+ channel, SkCa2. J Biol Chem. 2001 Nov 16;276(46):43145-51. doi: 10.1074/jbc.M106981200. Epub 2001 Aug 29.
Ref 92 Structural similarity between defense peptide from wheat and scorpion neurotoxin permits rational functional design. J Biol Chem. 2014 May 16;289(20):14331-40. doi: 10.1074/jbc.M113.530477. Epub 2014 Mar 26.
Ref 93 Experimental conversion of a defensin into a neurotoxin: implications for origin of toxic function. Mol Biol Evol. 2014 Mar;31(3):546-59. doi: 10.1093/molbev/msu038. Epub 2014 Jan 14.
Ref 94 First report on BaltCRP, a cysteine-rich secretory protein (CRISP) from Bothrops alternatus venom: Effects on potassium channels and inflammatory processes. Int J Biol Macromol. 2019 Nov 1;140:556-567. doi: 10.1016/j.ijbiomac.2019.08.108. Epub 2019 Aug 14.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.