General Information of This Target
Target ID
BTDT00066
Target Name
Potassium voltage-gated channel subfamily A member 5 (Kcna5)
Target Bioclass
Transporter and channel
Uniprot ID
P19024
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
Kcna5
Gene ID
25470
Synonym
RCK7; RK4; Voltage-gated potassium channel subunit Kv1.5
Sequence
MEISLVPLENGSAMTLRGGGEAGASCVQTPRGECGCPPTSGLNNQSKETLLRGRTTLEDA
NQGGRPLPPMAQELPQPRRLSAEDEEGEGDPGLGTVEEDQAPQDAGSLHHQRVLINISGL
RFETQLGTLAQFPNTLLGDPAKRLHYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPV
NVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSA
RAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGINGSVSGALSSG
PTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDVVAIFPYF
ITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASM
RELGLLIFFLFIGVILFSSAVYFAEADNHGSHFSSIPDAFWWAVVTMTTVGYGDMRPITV
GGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGNQRRESGLDTG
GQRKVSCSKASFCKTGGSLESSDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRET
DL

    Click to Show/Hide
Family
the potassium channel family
Function
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium- selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation. Homotetrameric channels display rapid activation and slow inactivation. May play a role in regulating the secretion of insulin in normal pancreatic islets.

    Click to Show/Hide
Taxonomy ID
10116
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Rodentia
Family: Muridae
Genus: Rattus
Species: Rattus norvegicus
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    N.vectensis toxin 4 Effect . [1]
 Toxin Info    N.vectensis toxin 5 Effect . [1]
 Toxin Info    Toxin MeKTx13-3 (G11R,I28M,G30R,D33H) Inhibition rate . [2- 21]
 Toxin Info    Toxin MeKTx13-3 (Q12A,K15A,K18A,D33R) Inhibition rate . [22]
 Toxin Info    Mu-conotoxin CnIIIC Inhibition rate . [23], [24], [25]
 Toxin Info    Crotamine Inhibition rate . [26]
 Toxin Info    Kappa-actitoxin-Bcs3a Inhibition rate . [27]
 Toxin Info    Defensin-like protein 1 Inhibition rate . [28]
 Toxin Info    Kappa-actitoxin-Bcs3b Inhibition rate . [27]
 Toxin Info    Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin Inhibition rate . [29]
 Toxin Info    PI-stichotoxin-Hcr2f Inhibition rate . [30]
 Toxin Info    PI-stichotoxin-Hcr2g Inhibition rate . [30]
 Toxin Info    Potassium channel toxin alpha-KTx 1.17 Inhibition rate . [31]
 Toxin Info    Potassium channel toxin alpha-KTx 3.13 Inhibition rate . [32]
 Toxin Info    Toxin PhcrTx2 Inhibition rate . [33]
 Toxin Info    Potassium channel toxin alpha-KTx 1.16 Inhibition rate . [31]
 Toxin Info    Potassium channel toxin alpha-KTx 3.18 Inhibition rate . [2- 21]
 Toxin Info    Potassium channel toxin alpha-KTx 4.1 Inhibition rate . [34]
 Toxin Info    Potassium channel toxin alpha-KTx 8.2 Inhibition rate . [35]
 Toxin Info    Potassium channel toxin alpha-KTx 8.5 Inhibition rate . [36]
 Toxin Info    Potassium channel toxin alpha-KTx 8.6 Inhibition rate . [35], [37]
 Toxin Info    Kappa-actitoxin-Bcs4a Inhibition rate . [38]
 Toxin Info    Potassium channel toxin AbeTx1 Inhibition rate . [39]
 Toxin Info    Potassium channel toxin AbeTx1 Inhibition rate . [39]
 Toxin Info    Potassium channel toxin alpha-KTx 8.6 Inhibition rate . [35]
 Toxin Info    Potassium channel toxin alpha-KTx 8.8 Inhibition rate . [40]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.1 Inhibition rate . [41]
 Toxin Info    Potassium channel toxin epsilon-KTx 1.2 Inhibition rate . [41]
 Toxin Info    Potassium channel toxin kappa-KTx 2.5 Inhibition rate . [42]
 Toxin Info    Potassium channel toxin TsTXK-beta Inhibition rate . [43]
 Toxin Info    Potassium channel toxin alpha-KTx 3.19 Inhibition rate . [22]
 Toxin Info    Apamin Inhibition rate . [44- 61]
 Toxin Info    Potassium channel toxin alpha-KTx 20.1 Inhibition rate . [62]
 Toxin Info    U-actitoxin-Oulsp1 Inhibition rate . [63]
 Toxin Info    U-actitoxin-Oulsp1 Inhibition rate . [64]
 Toxin Info    Potassium channel toxin alpha-KTx 16.4 Inhibition rate . [65]
 Toxin Info    Potassium channel toxin alpha-KTx 3.11 Inhibition rate . [66]
 Toxin Info    Kappa-actitoxin-Ate1a Inhibition rate . [67]
 Toxin Info    Potassium channel toxin alpha-KTx 3.2 Inhibition rate . [68]
 Toxin Info    Potassium channel toxin alpha-KTx 3.7 Inhibition rate . [68]
 Toxin Info    Potassium channel toxin alpha-KTx 3.6 Inhibition rate . [32]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 Inhibition rate . [69- 73]
 Toxin Info    KappaPI-actitoxin-Ael3a Inhibition rate . [74], [75]
 Toxin Info    Potassium channel toxin alpha-KTx 21.1 Inhibition rate
10 %
[71]
 Toxin Info    Potassium channel toxin alpha-KTx 12.2 Inhibition rate
25 %
[34]
 Toxin Info    Potassium channel toxin alpha-KTx 12.1 Inhibition rate
25 %
[34]
 Toxin Info    Pi-stichotoxin-Hcr5b Inhibition rate
42 %
[76]
References
Ref 1 The Birth and Death of Toxins with Distinct Functions: A Case Study in the Sea Anemone Nematostella. Mol Biol Evol. 2019 Sep 1;36(9):2001-2012. doi: 10.1093/molbev/msz132.
Ref 2 Retraction: Role of mesenchymal stem cells versus angiotensin converting enzyme inhibitor in kidney repair. Nephrology (Carlton). 2024 Apr;29(4):239. doi: 10.1111/nep.14278. Epub 2024 Feb 11.
Ref 3 Photogeneration and quenching of singlet molecular oxygen by bacterial C(40) carotenoids with long chain of conjugated double bonds. Photosynth Res. 2024 Mar;159(2-3):291-301. doi: 10.1007/s11120-023-01070-6. Epub 2024 Feb 5.
Ref 4 Density Functional Theory, Molecular Dynamics and AlteQ Studies Approaches of Baimantuoluoamide A and Baimantuoluoamide B to Identify Potential Inhibitors of M(pro) Proteins: a Novel Target for the Treatment of SARS COVID-19. JETP Lett. 2023 May 15:1-10. doi: 10.1134/S0021364023600039. Online ahead of print.
Ref 5 Melatonin Confers NaCl Tolerance in Withaniacoagulans L. by Maintaining Na(+)/K(+) Homeostasis, Strengthening the Antioxidant Defense System and Modulating Withanolides Synthesis-Related Genes. Russ J Plant Physiol. 2023;70(3):52. doi: 10.1134/S1021443723600125. Epub 2023 May 23.
Ref 6 Rhodococcus rhodochrous IEGM 1360, an Effective Biocatalyst of C3 Oxidative Transformation of Oleanane Triterpenoids. Microbiology (N Y). 2023;92(2):204-214. doi: 10.1134/S0026261722603360. Epub 2023 Apr 21.
Ref 7 Quaternary Ammonium Salt Strategy and Molecular Docking Studies of Novel 5-Acyl-8-(Arylamino)-Quinolines by Acetyl and Methanesulfonyl Chloride for Dual Evaluation Bioactivity. Russ J Bioorg Chem. 2023;49(2):367-375. doi: 10.1134/S1068162023020097. Epub 2023 Feb 21.
Ref 8 Erratum to: Prospects for the Use of Marine Sulfated Fucose-Rich Polysaccharides in Treatment and Prevention of COVID-19 and Post-COVID-19 Syndrome. Russ J Bioorg Chem. 2022;48(6):1372. doi: 10.1134/S1068162022340015. Epub 2022 Dec 23.
Ref 9 Current Trends and Approaches to the Search for Genetic Determinants of Aging and Longevity. Russ J Genet. 2022;58(12):1427-1443. doi: 10.1134/S1022795422120067. Epub 2022 Dec 28.
Ref 10 Design, Synthesis, Anti-Tubercular Evaluation and Teratogenicity Studies of Furanyl Pyrazolo[3,4-b] Quinoline-5-Ones. Russ J Bioorg Chem. 2023;49(1):127-138. doi: 10.1134/S1068162023010053. Epub 2022 Dec 22.
Ref 11 Rapid Assessment of Neutralizing Antibodies Using Influenza Viruses with a Luciferase Reporter. Appl Biochem Microbiol. 2022;58(7):878-886. doi: 10.1134/S0003683822070067. Epub 2022 Dec 6.
Ref 12 Analysis of adiabatic trapping phenomena for quasi-integrable area-preserving maps in the presence of time-dependent exciters. Phys Rev E. 2022 Sep;106(3-1):034204. doi: 10.1103/PhysRevE.106.034204.
Ref 13 Synthesis, Antiviral, and Antibacterial Activity of the Glycyrrhizic Acid and Glycyrrhetinic Acid Derivatives. Russ J Bioorg Chem. 2022;48(5):906-918. doi: 10.1134/S1068162022050132. Epub 2022 Jul 28.
Ref 14 Erratum to: Evaluation of the Effects of Favipiravir Combined with Vitamin C on Alveolar Bone in Rats. J Evol Biochem Physiol. 2022;58(3):941. doi: 10.1134/S0022093022030280. Epub 2022 Jun 29.
Ref 15 Design, Synthesis, and Molecular Docking Studies of Some New Quinoxaline Derivatives as EGFR Targeting Agents. Russ J Bioorg Chem. 2022;48(3):565-575. doi: 10.1134/S1068162022030220. Epub 2022 Jun 21.
Ref 16 Identification of Some Promising Heterocycles Useful in Treatment of Allergic Rhinitis: Virtual Screening, Pharmacophore Mapping, Molecular Docking, and Molecular Dynamics. Russ J Bioorg Chem. 2022;48(2):438-456. doi: 10.1134/S1068162022330019. Epub 2022 May 26.
Ref 17 Erratum to: Experimental Search for New Means of Pathogenetic Therapy COVID-19: Inhibitor of H2-Receptors Famotidine Increases the Effect of Oseltamivir on Survival and Immune Status of Mice Infected by A/PR/8/34 (H1N1). J Evol Biochem Physiol. 2022;58(2):623. doi: 10.1134/S0022093022020284. Epub 2022 May 16.
Ref 18 MicroRNAs as the Potential Regulators of SARS-CoV-2 Infection and Modifiers of the COVID-19 Clinical Features. Mol Biol. 2022;56(1):29-45. doi: 10.1134/S0026893322010034. Epub 2022 Feb 12.
Ref 19 Predators as Control Agents of Mosquito Larvae in Micro-Reservoirs (Review). Inland Water Biol. 2022;15(1):39-53. doi: 10.1134/S1995082922010138. Epub 2022 Mar 12.
Ref 20 Molecular Beacon DNA Probes with Fluorescein Bifluorophore. Russ J Bioorg Chem. 2021;47(3):734-740. doi: 10.1134/S1068162021030055. Epub 2021 Jun 11.
Ref 21 Synthesis, Molecular Docking, In Silico ADME Predictions, and Toxicity Studies of N-Substituted-5-(4-Chloroquinolin-2-yl)-1,3,4-Thiadiazol-2-Amine Derivatives as COVID-19 Inhibitors. Russ J Bioorg Chem. 2021;47(1):158-165. doi: 10.1134/S1068162021010155. Epub 2021 Mar 20.
Ref 22 Tuning Scorpion Toxin Selectivity: Switching From K(V)1.1 to K(V)1.3. Front Pharmacol. 2020 Jul 7;11:1010. doi: 10.3389/fphar.2020.01010. eCollection 2020.
Ref 23 A novel -conopeptide, CnIIIC, exerts potent and preferential inhibition of NaV1.2/1.4 channels and blocks neuronal nicotinic acetylcholine receptors. Br J Pharmacol. 2012 Jul;166(5):1654-68. doi: 10.1111/j.1476-5381.2012.01837.x.
Ref 24 Large-scale discovery of conopeptides and conoproteins in the injectable venom of a fish-hunting cone snail using a combined proteomic and transcriptomic approach. J Proteomics. 2012 Sep 18;75(17):5215-25. doi: 10.1016/j.jprot.2012.06.001. Epub 2012 Jun 13.
Ref 25 Peptide therapeutics from venom: Current status and potential. Bioorg Med Chem. 2018 Jun 1;26(10):2738-2758. doi: 10.1016/j.bmc.2017.09.029. Epub 2017 Sep 23.
Ref 26 Crotamine pharmacology revisited: novel insights based on the inhibition of KV channels. Mol Pharmacol. 2012 Jul;82(1):90-6. doi: 10.1124/mol.112.078188. Epub 2012 Apr 12.
Ref 27 Biochemical and electrophysiological characterization of two sea anemone type 1 potassium toxins from a geographically distant population of Bunodosoma caissarum. Mar Drugs. 2013 Mar 6;11(3):655-79. doi: 10.3390/md11030655.
Ref 28 The antifungal plant defensin AtPDF2.3 from Arabidopsis thaliana blocks potassium channels. Sci Rep. 2016 Aug 30;6:32121. doi: 10.1038/srep32121.
Ref 29 Cloning and expression of cDNA and genomic clones encoding three delayed rectifier potassium channels in rat brain. Neuron. 1990 Jun;4(6):929-39. doi: 10.1016/0896-6273(90)90146-7.
Ref 30 Kunitz-Type Peptides from the Sea Anemone Heteractis crispa Demonstrate Potassium Channel Blocking and Anti-Inflammatory Activities. Biomedicines. 2020 Nov 4;8(11):473. doi: 10.3390/biomedicines8110473.
Ref 31 K(V)1.2 channel-specific blocker from Mesobuthus eupeus scorpion venom: Structural basis of selectivity. Neuropharmacology. 2018 Dec;143:228-238. doi: 10.1016/j.neuropharm.2018.09.030. Epub 2018 Sep 22.
Ref 32 A potent potassium channel blocker from Mesobuthus eupeus scorpion venom. Biochimie. 2010 Dec;92(12):1847-53. doi: 10.1016/j.biochi.2010.08.003. Epub 2010 Aug 14.
Ref 33 PhcrTx2, a New Crab-Paralyzing Peptide Toxin from the Sea Anemone Phymanthus crucifer. Toxins (Basel). 2018 Feb 7;10(2):72. doi: 10.3390/toxins10020072.
Ref 34 Electrophysiological characterization of Ts6 and Ts7, K? channel toxins isolated through an improved Tityus serrulatus venom purification procedure. Toxins (Basel). 2014 Feb 28;6(3):892-913. doi: 10.3390/toxins6030892.
Ref 35 Molecular diversity and functional evolution of scorpion potassium channel toxins. Mol Cell Proteomics. 2011 Feb;10(2):M110.002832. doi: 10.1074/mcp.M110.002832. Epub 2010 Sep 30.
Ref 36 The first potassium channel toxin from the venom of the Iranian scorpion Odonthobuthus doriae. FEBS Lett. 2006 Nov 13;580(26):6254-8. doi: 10.1016/j.febslet.2006.10.029. Epub 2006 Oct 20.
Ref 37 Variability of Potassium Channel Blockers in Mesobuthus eupeus Scorpion Venom with Focus on Kv1.1: AN INTEGRATED TRANSCRIPTOMIC AND PROTEOMIC STUDY. J Biol Chem. 2015 May 8;290(19):12195-209. doi: 10.1074/jbc.M115.637611. Epub 2015 Mar 19.
Ref 38 BcsTx3 is a founder of a novel sea anemone toxin family of potassium channel blocker. FEBS J. 2013 Oct;280(19):4839-52. doi: 10.1111/febs.12456. Epub 2013 Aug 23.
Ref 39 AbeTx1 Is a Novel Sea Anemone Toxin with a Dual Mechanism of Action on Shaker-Type K? Channels Activation. Mar Drugs. 2018 Oct 1;16(10):360. doi: 10.3390/md16100360.
Ref 40 C-Terminal residues in small potassium channel blockers OdK1 and OSK3 from scorpion venom fine-tune the selectivity. Biochim Biophys Acta Proteins Proteom. 2017 May;1865(5):465-472. doi: 10.1016/j.bbapap.2017.02.001. Epub 2017 Feb 4.
Ref 41 Structural and Functional Elucidation of Peptide Ts11 Shows Evidence of a Novel Subfamily of Scorpion Venom Toxins. Toxins (Basel). 2016 Sep 30;8(10):288. doi: 10.3390/toxins8100288.
Ref 42 The new kappa-KTx 2.5 from the scorpion Opisthacanthus cayaporum. Peptides. 2011 Jul;32(7):1509-17. doi: 10.1016/j.peptides.2011.05.017. Epub 2011 May 23.
Ref 43 Ts8 scorpion toxin inhibits the Kv4.2 channel and produces nociception in?vivo. Toxicon. 2016 Sep 1;119:244-52. doi: 10.1016/j.toxicon.2016.06.014. Epub 2016 Jun 23.
Ref 44 The precursors of the bee venom constituents apamin and MCD peptide are encoded by two genes in tandem which share the same 3'-exon. J Biol Chem. 1995 May 26;270(21):12704-8. doi: 10.1074/jbc.270.21.12704.
Ref 45 The peptide components of bee venom. Eur J Biochem. 1976 Jan 15;61(2):369-76. doi: 10.1111/j.1432-1033.1976.tb10030.x.
Ref 46 Apamin as a selective blocker of the calcium-dependent potassium channel in neuroblastoma cells: voltage-clamp and biochemical characterization of the toxin receptor. Proc Natl Acad Sci U S A. 1982 Feb;79(4):1308-12. doi: 10.1073/pnas.79.4.1308.
Ref 47 Apamin, a blocker of the calcium-activated potassium channel, induces neurodegeneration of Purkinje cells exclusively. Brain Res. 1997 Dec 19;778(2):405-8. doi: 10.1016/s0006-8993(97)01165-7.
Ref 48 Determinants of apamin and d-tubocurarine block in SK potassium channels. J Biol Chem. 1997 Sep 12;272(37):23195-200. doi: 10.1074/jbc.272.37.23195.
Ref 49 Pharmacological characterization of small-conductance Ca(2+)-activated K(+) channels stably expressed in HEK 293 cells. Br J Pharmacol. 2000 Mar;129(5):991-9. doi: 10.1038/sj.bjp.0703120.
Ref 50 SK3 is an important component of K(+) channels mediating the afterhyperpolarization in cultured rat SCG neurones. J Physiol. 2001 Sep 1;535(Pt 2):323-34. doi: 10.1111/j.1469-7793.2001.00323.x.
Ref 51 Apamin interacts with all subtypes of cloned small-conductance Ca2+-activated K+ channels. Pflugers Arch. 2001 Jan;441(4):544-50. doi: 10.1007/s004240000447.
Ref 52 An amino acid outside the pore region influences apamin sensitivity in small conductance Ca2+-activated K+ channels. J Biol Chem. 2007 Feb 9;282(6):3478-86. doi: 10.1074/jbc.M607213200. Epub 2006 Dec 1.
Ref 53 Apamin reduces neuromuscular transmission by activating inhibitory muscarinic M(2) receptors on motor nerve terminals. Eur J Pharmacol. 2010 Jan 25;626(2-3):239-43. doi: 10.1016/j.ejphar.2009.09.064. Epub 2009 Oct 8.
Ref 54 Allosteric block of KCa2 channels by apamin. J Biol Chem. 2010 Aug 27;285(35):27067-27077. doi: 10.1074/jbc.M110.110072. Epub 2010 Jun 18.
Ref 55 The small neurotoxin apamin blocks not only small conductance Ca(2+) activated K(+) channels (SK type) but also the voltage dependent Kv1.3 channel. Eur Biophys J. 2017 Sep;46(6):517-523. doi: 10.1007/s00249-016-1196-0. Epub 2017 Jan 20.
Ref 56 Apamin inhibits TNF-- and IFN--induced inflammatory cytokines and chemokines via suppressions of NF-B signaling pathway and STAT in human keratinocytes. Pharmacol Rep. 2017 Oct;69(5):1030-1035. doi: 10.1016/j.pharep.2017.04.006. Epub 2017 Apr 18.
Ref 57 Apamin Suppresses LPS-Induced Neuroinflammatory Responses by Regulating SK Channels and TLR4-Mediated Signaling Pathways. Int J Mol Sci. 2020 Jun 17;21(12):4319. doi: 10.3390/ijms21124319.
Ref 58 Apamin from bee venom suppresses inflammation in a murine model of gouty arthritis. J Ethnopharmacol. 2020 Jul 15;257:112860. doi: 10.1016/j.jep.2020.112860. Epub 2020 Apr 11.
Ref 59 Antioxidative, Antiapoptotic, and Anti-Inflammatory Effects of Apamin in a Murine Model of Lipopolysaccharide-Induced Acute Kidney Injury. Molecules. 2020 Dec 3;25(23):5717. doi: 10.3390/molecules25235717.
Ref 60 Solution structure of apamin determined by nuclear magnetic resonance and distance geometry. Biochemistry. 1988 Nov 1;27(22):8491-8. doi: 10.1021/bi00422a029.
Ref 61 Binding and toxicity of apamin. Characterization of the active site. Eur J Biochem. 1991 Mar 28;196(3):639-45. doi: 10.1111/j.1432-1033.1991.tb15860.x.
Ref 62 A novel toxin from the venom of the scorpion Tityus trivittatus, is the first member of a new alpha-KTX subfamily. FEBS Lett. 2006 Jan 23;580(2):592-6. doi: 10.1016/j.febslet.2005.12.073. Epub 2006 Jan 4.
Ref 63 Sunanda, Punnepalli, et al. "Identification, chemical synthesis, structure, and function of a new KV1 channel blocking peptide from Oulactis sp." Peptide Science 110.4 (2018): e24073.
Ref 64 Structure, folding and stability of a minimal homologue from Anemonia sulcata of the sea anemone potassium channel blocker ShK. Peptides. 2018 Jan;99:169-178. doi: 10.1016/j.peptides.2017.10.001. Epub 2017 Oct 6.
Ref 65 Molecular divergence of two orthologous scorpion toxins affecting potassium channels. Comp Biochem Physiol A Mol Integr Physiol. 2011 Jul;159(3):313-21. doi: 10.1016/j.cbpa.2011.03.027. Epub 2011 Apr 3.
Ref 66 OdK2, a Kv1.3 channel-selective toxin from the venom of the Iranian scorpion Odonthobuthus doriae. Toxicon. 2008 Jun 15;51(8):1424-30. doi: 10.1016/j.toxicon.2008.03.027. Epub 2008 Mar 29.
Ref 67 PHAB toxins: a unique family of predatory sea anemone toxins evolving via intra-gene concerted evolution defines a new peptide fold. Cell Mol Life Sci. 2018 Dec;75(24):4511-4524. doi: 10.1007/s00018-018-2897-6. Epub 2018 Aug 14.
Ref 68 Fluorescent protein-scorpion toxin chimera is a convenient molecular tool for studies of potassium channels. Sci Rep. 2016 Sep 21;6:33314. doi: 10.1038/srep33314.
Ref 69 Proteomic endorsed transcriptomic profiles of venom glands from Tityus obscurus and T. serrulatus scorpions. PLoS One. 2018 Mar 21;13(3):e0193739. doi: 10.1371/journal.pone.0193739. eCollection 2018.
Ref 70 Novel components of Tityus serrulatus venom: A transcriptomic approach. Toxicon. 2021 Jan 15;189:91-104. doi: 10.1016/j.toxicon.2020.11.001. Epub 2020 Nov 10.
Ref 71 Purification and characterization of Ts15, the first member of a new -KTX subfamily from the venom of the Brazilian scorpion Tityus serrulatus. Toxicon. 2011 Jul;58(1):54-61. doi: 10.1016/j.toxicon.2011.05.001. Epub 2011 May 13.
Ref 72 Moving pieces in a venomic puzzle: unveiling post-translationally modified toxins from Tityus serrulatus. J Proteome Res. 2013 Jul 5;12(7):3460-70. doi: 10.1021/pr4003068. Epub 2013 Jun 13.
Ref 73 Influence of post-starvation extraction time and prey-specific diet in Tityus serrulatus scorpion venom composition and hyaluronidase activity. Toxicon. 2014 Nov;90:326-36. doi: 10.1016/j.toxicon.2014.08.064. Epub 2014 Sep 6.
Ref 74 A bifunctional sea anemone peptide with Kunitz type protease and potassium channel inhibiting properties. Biochem Pharmacol. 2011 Jul 1;82(1):81-90. doi: 10.1016/j.bcp.2011.03.023. Epub 2011 Apr 6.
Ref 75 Development of a rational nomenclature for naming peptide and protein toxins from sea anemones. Toxicon. 2012 Sep 15;60(4):539-50. doi: 10.1016/j.toxicon.2012.05.020. Epub 2012 Jun 5.
Ref 76 A Tale of Toxin Promiscuity: The Versatile Pharmacological Effects of Hcr 1b-2 Sea Anemone Peptide on Voltage-Gated Ion Channels. Mar Drugs. 2022 Feb 17;20(2):147. doi: 10.3390/md20020147.
Ref 77 First report on BaltCRP, a cysteine-rich secretory protein (CRISP) from Bothrops alternatus venom: Effects on potassium channels and inflammatory processes. Int J Biol Macromol. 2019 Nov 1;140:556-567. doi: 10.1016/j.ijbiomac.2019.08.108. Epub 2019 Aug 14.
Ref 78 Structural similarity between defense peptide from wheat and scorpion neurotoxin permits rational functional design. J Biol Chem. 2014 May 16;289(20):14331-40. doi: 10.1074/jbc.M113.530477. Epub 2014 Mar 26.
Ref 79 Experimental conversion of a defensin into a neurotoxin: implications for origin of toxic function. Mol Biol Evol. 2014 Mar;31(3):546-59. doi: 10.1093/molbev/msu038. Epub 2014 Jan 14.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.