Target Information
General Information of This Target
| Target ID |
BTDT00157
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Potassium voltage-gated channel subfamily D member 2 (Kcnd2)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
Kcnd2
|
|||||
| Gene ID | ||||||
| Synonym |
RK5; Shal1; Voltage-gated potassium channel subunit Kv4.2
|
|||||
| Sequence |
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTGESALPTMTARQRVWRAFENPHT STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEPAFVSKSGSSFETQHHH LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKSFRI PNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI PTPPVTTPEGDDRPESPEYSGGNIVRVSAL Click to Show/Hide
|
|||||
| Family |
the potassium channel family
|
|||||
| Function |
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain, but also in rodent heart. Mediates the major part of the dendritic A-type current I(SA) in brain neurons. This current is activated at membrane potentials that are below the threshold for action potentials. It regulates neuronal excitability, prolongs the latency before the first spike in a series of action potentials, regulates the frequency of repetitive action potential firing, shortens the duration of action potentials and regulates the back-propagation of action potentials from the neuronal cell body to the dendrites. Contributes to the regulation of the circadian rhythm of action potential firing in suprachiasmatic nucleus neurons, which regulates the circadian rhythm of locomotor activity. Functions downstream of the metabotropic glutamate receptor GRM5 and plays a role in neuronal excitability and in nociception mediated by activation of GRM5. Mediates the transient outward current I(to) in rodent heart left ventricle apex cells, but not in human heart, where this current is mediated by another family member. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCND2 and KCND3; channel properties depend on the type of pore-forming alpha subunits that are part of the channel. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes. Interaction with specific isoforms of the regulatory subunits KCNIP1, KCNIP2, KCNIP3 or KCNIP4 strongly increases expression at the cell surface and thereby increases channel activity; it modulates the kinetics of channel activation and inactivation, shifts the threshold for channel activation to more negative voltage values, shifts the threshold for inactivation to less negative voltages and accelerates recovery after inactivation. Likewise, interaction with DPP6 or DPP10 promotes expression at the cell membrane and regulates both channel characteristics and activity.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Defensin-like protein 1 | Inhibition rate | . | [1] |
| Toxin Info Crotamine | Inhibition rate | . | [2] |
| Toxin Info Kappa-actitoxin-Bcs3a | Inhibition rate | . | [3] |
| Toxin Info Kappa-actitoxin-Bcs3b | Inhibition rate | . | [3] |
| Toxin Info Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | Inhibition rate | . | [4] |
| Toxin Info Potassium channel toxin alpha-KTx 1.17 | Inhibition rate | . | [5] |
| Toxin Info Toxin PhcrTx2 | Inhibition rate | . | [6] |
| Toxin Info Kunitz-type serine protease inhibitor homolog dendrotoxin I | Inhibition rate | . | [4] |
| Toxin Info Potassium channel toxin alpha-KTx 1.15 | Inhibition rate | . | [7] |
| Toxin Info Potassium channel toxin alpha-KTx 1.16 | Inhibition rate | . | [5] |
| Toxin Info Potassium channel toxin alpha-KTx 8.8 | Inhibition rate | . | [8] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.2 | Inhibition rate | . | [9] |
| Toxin Info Potassium channel toxin kappa-KTx 2.5 | Inhibition rate | . | [10] |
| Toxin Info Kappa-actitoxin-Bcs4a | Inhibition rate | . | [11] |
| Toxin Info Potassium channel toxin AbeTx1 | Inhibition rate | . | [12] |
| Toxin Info Potassium channel toxin AbeTx1 | Inhibition rate | . | [12] |
| Toxin Info U-actitoxin-Oulsp1 | Inhibition rate | . | [13] |
| Toxin Info U-actitoxin-Oulsp1 | Inhibition rate | . | [14] |
| Toxin Info Mu-theraphotoxin-Pspp1 | Inhibition rate | . | [15] |
| Toxin Info Kappa-actitoxin-Ate1a | Inhibition rate | . | [16] |
| Toxin Info APETx2 | Inhibition rate | . | [17- 26] |
| Toxin Info Potassium channel toxin alpha-KTx 21.1 | Inhibition rate | . | [27] |
| Toxin Info Potassium channel toxin alpha-KTx 21.1 | Inhibition rate | . | [27- 31] |
| Toxin Info KappaPI-actitoxin-Ael3a | Inhibition rate | . | [32], [33] |
| Toxin Info Pi-stichotoxin-Hcr5b | Inhibition rate |
5 %
|
[34] |
| Toxin Info BmK86-P1 | Inhibition rate |
11 %
|
[35] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.2 | Inhibition rate |
20 %
|
[9- 37] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.1 | Inhibition rate |
25 %
|
[9] |
| Toxin Info Potassium channel toxin epsilon-KTx 1.1 | Inhibition rate |
25 %
|
[9- 37] |
| Toxin Info Kappa-theraphotoxin-Ps1a | IC50 |
5 nM
|
[38], [39], [40] |
| Toxin Info JZTX-V (Y1A) | IC50 |
7 nM
|
[41] |
| Toxin Info JZTX-V (K12A) | IC50 |
10 nM
|
[41] |
| Toxin Info JZTX-V (S11A) | IC50 |
10 nM
|
[41] |
| Toxin Info Beta/kappa-theraphotoxin-Cg2a | IC50 |
13.2 nM
|
[42- 47] |
| Toxin Info JZTX-V (K4A) | IC50 |
14 nM
|
[41] |
| Toxin Info JZTX-V (I28A) | IC50 |
15 nM
|
[41] |
| Toxin Info JZTX-V (L23A) | IC50 |
15 nM
|
[41] |
| Toxin Info JZTX-V (Q3A) | IC50 |
18 nM
|
[41] |
| Toxin Info JZTX-V (R13A) | IC50 |
18 nM
|
[41] |
| Toxin Info JZTX-V (I29A) | IC50 |
20 nM
|
[41] |
| Toxin Info JZTX-V (K27A) | IC50 |
33 nM
|
[41] |
| Toxin Info Kappa-theraphotoxin-Ps1b | IC50 |
34 nM
|
[38] |
| Toxin Info JZTX-V (E17A) | IC50 |
55 nM
|
[41] |
| Toxin Info Kappa-sparatoxin-Hv1c | IC50 |
67 nM
|
[48] |
| Toxin Info Jingzhaotoxin F7-15.33 | IC50 |
68 nM
|
[43] |
| Toxin Info Kappa-theraphotoxin-Gr1a | IC50 |
100 nM
|
[49- 55] |
| Toxin Info Kappa-sparatoxin-Hv1a | IC50 |
100 nM
|
[48] |
| Toxin Info Kappa-sparatoxin-Hv1b | IC50 |
100 nM
|
[56] |
| Toxin Info JZTX-V (K22A) | IC50 |
125 nM
|
[41] |
| Toxin Info Kappa-LhTx-1 | IC50 |
140 nM
|
[57] |
| Toxin Info JZTX-V (W7A) | IC50 |
172 nM
|
[41] |
| Toxin Info JZTX-V (W5A) | IC50 |
180 nM
|
[41] |
| Toxin Info JZTX-V (R20A) | IC50 |
194 nM
|
[41] |
| Toxin Info JZTX-V (M6A) | IC50 |
312 nM
|
[41] |
| Toxin Info Potassium channel toxin TsTXK-beta | IC50 |
652 nM
|
[29- 62] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
