Target Information
General Information of This Target
| Target ID |
BTDT00060
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Potassium voltage-gated channel subfamily A member 6 (KCNA6)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
KCNA6
|
|||||
| Gene ID | ||||||
| Synonym |
Voltage-gated potassium channel HBK2; Voltage-gated potassium channel subunit Kv1.6
|
|||||
| Sequence |
MRSEKSLTLAAPGEVRGPEGEQQDAGDFPEAGGGGGCCSSERLVINISGLRFETQLRTLS
LFPDTLLGDPGRRVRFFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFLEE IRFYQLGDEALAAFREDEGCLPEGGEDEKPLPSQPFQRQVWLLFEYPESSGPARGIAIVS VLVILISIVIFCLETLPQFRVDGRGGNNGGVSRVSPVSRGSQEEEEDEDDSYTFHHGITP GEMGTGGSSSLSTLGGSFFTDPFFLVETLCIVWFTFELLVRFSACPSKPAFFRNIMNIID LVAIFPYFITLGTELVQQQEQQPASGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSK GLQILGKTLQASMRELGLLIFFLFIGVILFSSAVYFAEADDDDSLFPSIPDAFWWAVVTM TTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETEQEEQGQYTHV TCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAEKRMLTEV Click to Show/Hide
|
|||||
| Family |
the potassium channel family
|
|||||
| Function |
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium- selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA6, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation. Homotetrameric channels display rapid activation and slow inactivation.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| TCDB ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Bgk (W5Y,Y26F) | Dissociation constant |
4 pM
|
[1] |
| Toxin Info Venom basic protease inhibitor 1 homolog (L3R,Q18D,G34R,T36D,R59G) | Dissociation constant |
0.037 nM
|
[1] |
| Toxin Info Potassium channel toxin Bgk (W5Y,F6A,Y26F) | Dissociation constant |
0.07 nM
|
[1] |
| Toxin Info Potassium channel toxin ShK ([pTyr][AEEA]) | Dissociation constant |
18 nM
|
[2] |
| Toxin Info Kappa-actitoxin-Bgr1a | Inhibition constant |
0.013 nM
|
[1] |
| Toxin Info Bgk (W5Y,Y26F) | Inhibition constant |
0.014 nM
|
[1] |
| Toxin Info Bgk (W5Y,F6A,Y26F) | Inhibition constant |
0.162 nM
|
[1] |
| Toxin Info Neurotoxin HsTX1 (R14A) | Inhibition rate | . | [3] |
| Toxin Info Kappa-conotoxin RIIIK | Inhibition rate | . | [4] |
| Toxin Info Potassium channel toxin alpha-KTx 4.8 | Inhibition rate | . | [5] |
| Toxin Info Kunitz-type conkunitzin-S1 | Inhibition rate | . | [6], [7], [8] |
| Toxin Info Potassium channel toxin alpha-KTx 1.15 | Inhibition rate |
5 %
|
[9] |
| Toxin Info ChTX (M29I) | Inhibition rate |
9.6 %
|
[10] |
| Toxin Info Potassium channel toxin ShK ([Pmp][AEEA],M21[Nle]) | Inhibition rate |
10 %
|
[11] |
| Toxin Info BmK86-P1 | Inhibition rate |
11 %
|
[12] |
| Toxin Info Potassium channel toxin ShK ([Pmp][AEEA]) | Inhibition rate |
25 %
|
[11] |
| Toxin Info Potassium channel toxin ShK (Q16K,37A) | Inhibition rate |
25 %
|
[11] |
| Toxin Info Potassium channel toxin ShK (Q16K,M21I,37A) | Inhibition rate |
25 %
|
[11] |
| Toxin Info Beta-defensin 3 | Inhibition rate |
31 %
|
[13] |
| Toxin Info Kappa-conotoxin SrXIA | Inhibition rate |
58 %
|
[14], [15] |
| Toxin Info Kappa-stichotoxin-She3a | IC50 |
0.165 nM
|
[16] |
| Toxin Info Potassium channel toxin ShK (K22[Dap]) | IC50 |
10.5 nM
|
[16] |
| Toxin Info ([20kDa-PEG] -(Lys16)-ShK | IC50 |
466 nM
|
[17] |
| Toxin Info Conorfamide-Sr3 | IC50 |
2.7 μM
|
[18] |
| Toxin Info Conorfamide-Sr3 | IC50 |
2.7 μM
|
[19], [18] |
| Toxin Info Kappa-conotoxin RIIIJ | IC50 |
8 μM
|
[4] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
