Target Information

General Information of This Target
Target ID
BTDT00127
Target Name
Potassium voltage-gated channel subfamily D member 1 (Kcnd1)
Target Bioclass
Transporter and channel
Uniprot ID
Q03719
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
Kcnd1
Gene ID
16506
Synonym
Voltage-gated potassium channel subunit Kv4.1
Sequence
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDAESGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGEGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGTPRWPSKEQSCGDRFPTAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTSKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGDGQMLCVRSRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGRTSRSTSVSSQPMGPGSLFSSCCSRRVNRR
AIRLANSTASVSRGSMQELDTLAGLRRSPAPQTRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPSGGGGSGGTPNTTLRNSSLGTPCLLPETVKISSL

    Click to Show/Hide
Family
the potassium channel family
Function
Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in the heart and I(Sa) current in neurons. Channel properties are modulated by subunit assembly.

    Click to Show/Hide
Taxonomy ID
10090
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Rodentia
Family: Muridae
Genus: Mus
Species: Mus musculus
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Kappa-sparatoxin-Hv1b Dissociation constant
7.1 μM
 [1]
 Toxin Info    Potassium channel toxin alpha-KTx 1.15 Inhibition rate . [2]
 Toxin Info    Mu-theraphotoxin-Pspp1 Inhibition rate . [3]
 Toxin Info    Kappa-theraphotoxin-Sc1a Inhibition rate . [4]
 Toxin Info    Kappa-theraphotoxin-Hm2a Inhibition rate . [4]
 Toxin Info    BmK86-P1 Inhibition rate
3 %
 [5]
 Toxin Info    Toxin (3D,F4D,N6G,L7K,R8L,R9F,C10S,E11G,L12C,S13D,C14T,R15N,S16A,L17D,G18C,L19C,L20E,K22Y,C23V,I24C,G25R,E26L,E27W,C30L,V31D,P32W) Inhibition rate
30 %
 [1]
 Toxin Info    Kappa-theraphotoxin-Ps1a Inhibition rate
39 %
 [6], [7], [8]
 Toxin Info    Delta-theraphotoxin-Hm1a IC50
280 nM
 [4- 11]
 Toxin Info    Kappa-LhTx-1 IC50
870 nM
 [12]
References
Ref 1 Heteropoda toxin 2 is a gating modifier toxin specific for voltage-gated K+ channels of the Kv4 family. Toxicon. 2005 Mar 15;45(4):431-42. doi: 10.1016/j.toxicon.2004.11.015.
Ref 2 Different pharmacological properties between scorpion toxin BmKcug2 and its degraded analogs highlight the diversity of K(+) channel blockers from thermally processed scorpions. Int J Biol Macromol. 2021 May 1;178:143-153. doi: 10.1016/j.ijbiomac.2021.02.155. Epub 2021 Feb 23.
Ref 3 Chemical Synthesis, Proper Folding, Na(v) Channel Selectivity Profile and Analgesic Properties of the Spider Peptide Phlotoxin 1. Toxins (Basel). 2019 Jun 21;11(6):367. doi: 10.3390/toxins11060367.
Ref 4 Novel tarantula toxins for subtypes of voltage-dependent potassium channels in the Kv2 and Kv4 subfamilies. Mol Pharmacol. 2002 Jul;62(1):48-57. doi: 10.1124/mol.62.1.48.
Ref 5 BmK86-P1, a New Degradation Peptide with Desirable Thermostability and Kv1.2 Channel-Specific Activity from Traditional Chinese Scorpion Medicinal Material. Toxins (Basel). 2021 Aug 30;13(9):610. doi: 10.3390/toxins13090610.
Ref 6 Effects of phrixotoxins on the Kv4 family of potassium channels and implications for the role of Ito1 in cardiac electrogenesis. Br J Pharmacol. 1999 Jan;126(1):251-63. doi: 10.1038/sj.bjp.0702283.
Ref 7 Studies examining the relationship between the chemical structure of protoxin II and its activity on voltage gated sodium channels. J Med Chem. 2014 Aug 14;57(15):6623-31. doi: 10.1021/jm500687u. Epub 2014 Jul 24.
Ref 8 Solution structure of Phrixotoxin 1, a specific peptide inhibitor of Kv4 potassium channels from the venom of the theraphosid spider Phrixotrichus auratus. Protein Sci. 2004 May;13(5):1197-208. doi: 10.1110/ps.03584304.
Ref 9 Selective spider toxins reveal a role for the Nav1.1 channel in mechanical pain. Nature. 2016 Jun 23;534(7608):494-9. doi: 10.1038/nature17976. Epub 2016 Jun 6.
Ref 10 A selective Na(V)1.1 activator with potential for treatment of Dravet syndrome epilepsy. Biochem Pharmacol. 2020 Nov;181:113991. doi: 10.1016/j.bcp.2020.113991. Epub 2020 Apr 23.
Ref 11 Selective Na(V)1.1 activation rescues Dravet syndrome mice from seizures and premature death. Proc Natl Acad Sci U S A. 2018 Aug 21;115(34):E8077-E8085. doi: 10.1073/pnas.1804764115. Epub 2018 Aug 3.
Ref 12 Variation of Two S3b Residues in K(V)4.1-4.3 Channels Underlies Their Different Modulations by Spider Toxin -LhTx-1. Front Pharmacol. 2021 Jun 10;12:692076. doi: 10.3389/fphar.2021.692076. eCollection 2021.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.