Target Information
General Information of This Target
| Target ID |
BTDT00070
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Potassium voltage-gated channel subfamily C member 2 (Kcnc2)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
Kcnc2
|
|||||
| Gene ID | ||||||
| Synonym |
Potassium channel voltage-gated Shaw-related subfamily C member 2; Shaw-like potassium channel; Voltage-gated potassium channel subunit Kv3.2
|
|||||
| Sequence |
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLASSEPQGDCLTAAGDKLQPLPPP
LSPPPRPPPLSPVPSGCFEGGAGNCSSHGGNGSDHPGGGREFFFDRHPGVFAYVLNYYRT GKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGDPG DDEDLGGKRLGIEDAAGLGGPDGKSGRWRKLQPRMWALFEDPYSSRAARFIAFASLFFIL VSITTFCLETHEAFNIVKNKTEPVINGTSAVLQYEIETDPALTYVEGVCVVWFTFEFLVR IVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFK LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEHTQ FKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY SLAMAKQKLPRKRKKHIPPAPLASSPTFCKTELNMACNSTQSDTCLGKENRLLEHNRSVL SGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKSRS LNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL Click to Show/Hide
|
|||||
| Family |
the potassium channel family
|
|||||
| Function |
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. Contributes to the regulation of the fast action potential repolarization and in sustained high-frequency firing in neurons of the central nervous system. Homotetramer channels mediate delayed-rectifier voltage-dependent potassium currents that activate rapidly at high-threshold voltages and inactivate slowly. Forms tetrameric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNC1, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties may be modulated either by the association with ancillary subunits, such as KCNE1, KCNE2 and KCNE3 or indirectly by nitric oxide (NO) through a cGMP- and PKG-mediated signaling cascade, slowing channel activation and deactivation of delayed rectifier potassium channels. Contributes to fire sustained trains of very brief action potentials at high frequency in retinal ganglion cells, thalamocortical and suprachiasmatic nucleus (SCN) neurons and in hippocampal and neocortical interneurons. Sustained maximal action potential firing frequency in inhibitory hippocampal interneurons is negatively modulated by histamine H2 receptor activation in a cAMP- and protein kinase (PKA) phosphorylation-dependent manner. Plays a role in maintaining the fidelity of synaptic transmission in neocortical GABAergic interneurons by generating action potential (AP) repolarization at nerve terminals, thus reducing spike-evoked calcium influx and GABA neurotransmitter release. Required for long-range synchronization of gamma oscillations over distance in the neocortex. Contributes to the modulation of the circadian rhythm of spontaneous action potential firing in suprachiasmatic nucleus (SCN) neurons in a light-dependent manner.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Potassium channel toxin ShK ([pTyr],[AEEA]) | Dissociation constant |
20 nM
|
[1] |
| Toxin Info OsK1 (E16A,K20D) | Inhibition rate | . | [2] |
| Toxin Info Potassium channel toxin alpha-KTx 32.1 | Inhibition rate | . | [2] |
| Toxin Info Kunitz-type conkunitzin-S1 | Inhibition rate | . | [3], [4], [5] |
| Toxin Info Mu-theraphotoxin-Pspp1 | Inhibition rate | . | [6] |
| Toxin Info Potassium channel toxin alpha-KTx 3.7 | Inhibition rate | . | [2] |
| Toxin Info Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin | Inhibition rate | . | [7] |
| Toxin Info Potassium channel toxin ShK ([Ppa],[AEEA],M21[Nle]) | IC50 |
4.2 nM
|
[8] |
| Toxin Info Potassium channel toxin ShK ([pTyr][AEEA]) | IC50 |
20 nM
|
[8] |
| Toxin Info OsK1 (T,E14K,K18D) | IC50 |
65 nM
|
[2] |
| Toxin Info OsK1 (V,E14K,K18D) | IC50 |
95 nM
|
[2] |
| Toxin Info OsK1 (GV,E14K,K18D) | IC50 |
1 μM
|
[2] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
