General Information of This Target
Target ID
BTDT00117
Target Name
Potassium voltage-gated channel subfamily KQT member 1 (Kcnq1)
Target Bioclass
Transporter and channel
Uniprot ID
P97414
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
Kcnq1
Gene ID
16535
Synonym
IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; KQT-like 1; Voltage-gated potassium channel subunit Kv7.1
Sequence
MDTASSPPSAERKRAGWSRLLGARRGSAVVKKCPFSLELAEGGPEGSTVYAPIAPTGAPG
LAPPMSTPVSPAPAPADLGPRPRVSLDPRVSIYSARRPLLARTHIQGRVYNFLERPTGWK
CFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCR
SKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHV
DRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYAD
ALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQ
KHFNRQIPAAASLIQTAWRCYAAENPDSATWKIYVRKPARSHTLLSPSPKPKKSVMVKKK
KFKLDKDNGMSPGEKMFNVPHITYDPPEDRRPDHFSIDGYDSSVRKSPTLLEVSTPHFLR
TNSFAEDLDLEGETLLTPITHVSQLRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDV
IEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQ
LDQRLVIITDMLHQLLSMQQGGPTCNSRSQVVASNEGGSINPELFLPSNSLPTYEQLTVP
QTGPDEGS

    Click to Show/Hide
Family
the potassium channel family
Function
Potassium channel that plays an important role in a number of tissues, including heart, inner ear, stomach and colon . Associates with KCNE beta subunits that modulates current kinetics . Induces a voltage-dependent by rapidly activating and slowly deactivating potassium-selective outward current . Promotes also a delayed voltage activated potassium current showing outward rectification characteristic. During beta-adrenergic receptor stimulation participates in cardiac repolarization by associating with KCNE1 to form the I(Ks) cardiac potassium current that increases the amplitude and slows down the activation kinetics of outward potassium current I(Ks) . Muscarinic agonist oxotremorine-M strongly suppresses KCNQ1/KCNE1 current. When associated with KCNE3, forms the potassium channel that is important for cyclic AMP-stimulated intestinal secretion of chloride ions. This interaction with KCNE3 is reduced by 17beta-estradiol, resulting in the reduction of currents. During conditions of increased substrate load, maintains the driving force for proximal tubular and intestinal sodium ions absorption, gastric acid secretion, and cAMP-induced jejunal chloride ions secretion. Allows the provision of potassium ions to the luminal membrane of the secretory canaliculus in the resting state as well as during stimulated acid secretion. When associated with KCNE2, forms an heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current. When associated with KCNE4, inhibits voltage-gated potassium channel activity. When associated with KCNE5, this complex only conducts current upon strong and continued depolarization. Also forms a heterotetramer with KCNQ5; has a voltage-gated potassium channel activity. Binds with phosphatidylinositol 4,5-bisphosphate. KCNQ1-KCNE2 channel associates with Na(+)-coupled myo-inositol symporter in the apical membrane of choroid plexus epithelium and regulates the myo- inositol gradient between blood and cerebrospinal fluid with an impact on neuron excitability.

    Click to Show/Hide
Taxonomy ID
10090
TCDB ID
1.A.1.15.1
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Rodentia
Family: Muridae
Genus: Mus
Species: Mus musculus
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Potassium channel toxin alpha-KTx 30.1 Inhibition rate
4 %
[1]
 Toxin Info    Kappa-theraphotoxin-Hm2a Inhibition rate
4 %
[2]
 Toxin Info    Delta-theraphotoxin-Hm1a Inhibition rate
8 %
[2], [3], [4], [5]
 Toxin Info    Toxin ImKTx104 (K23A) Inhibition rate
15.5 %
[1]
 Toxin Info    Toxin ImKTx104 (K23A) Inhibition rate
16 %
[1]
 Toxin Info    Potassium channel toxin kappa-KTx 2.7 Inhibition rate
18 %
[1]
 Toxin Info    Kappa-theraphotoxin-Sc1a Inhibition rate
19 %
[2]
 Toxin Info    Toxin ImKTx104 (K25A) Inhibition rate
21 %
[1]
 Toxin Info    Toxin ImKTx104 (K25A) Inhibition rate
21.4 %
[1]
 Toxin Info    Toxin ImKTx104 (D14A) Inhibition rate
25.6 %
[1]
 Toxin Info    Toxin ImKTx104 (D14A) Inhibition rate
26 %
[1]
 Toxin Info    Potassium channel toxin alpha-KTx 29.1 Inhibition rate
27 %
[1]
 Toxin Info    Potassium channel toxin alpha-KTx 29.2 Inhibition rate
27 %
[1]
 Toxin Info    Potassium channel toxin kappa-KTx 2.8 Inhibition rate
45 %
[1]
 Toxin Info    Potassium channel toxin alpha-KTx 28.1 IC50
11.69 μM
[1]
References
Ref 1 Structural and functional diversity of acidic scorpion potassium channel toxins. PLoS One. 2012;7(4):e35154. doi: 10.1371/journal.pone.0035154. Epub 2012 Apr 12.
Ref 2 Novel tarantula toxins for subtypes of voltage-dependent potassium channels in the Kv2 and Kv4 subfamilies. Mol Pharmacol. 2002 Jul;62(1):48-57. doi: 10.1124/mol.62.1.48.
Ref 3 Selective spider toxins reveal a role for the Nav1.1 channel in mechanical pain. Nature. 2016 Jun 23;534(7608):494-9. doi: 10.1038/nature17976. Epub 2016 Jun 6.
Ref 4 A selective Na(V)1.1 activator with potential for treatment of Dravet syndrome epilepsy. Biochem Pharmacol. 2020 Nov;181:113991. doi: 10.1016/j.bcp.2020.113991. Epub 2020 Apr 23.
Ref 5 Selective Na(V)1.1 activation rescues Dravet syndrome mice from seizures and premature death. Proc Natl Acad Sci U S A. 2018 Aug 21;115(34):E8077-E8085. doi: 10.1073/pnas.1804764115. Epub 2018 Aug 3.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.