General Information of This Target
Target ID
BTDT00210
Target Name
Immunoglobulin kappa variable 1-39 (IGKV1-39);Potassium voltage-gated channel subfamily A member 2 (KCNA2)
Target Bioclass
Transporter and channel
Uniprot ID
P01597 ; P16389
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
IGKV1-39;KCNA2
Gene ID
. ; 3737
Synonym 1
Ig kappa chain V-I region DEE; Ig kappa chain V-I region Hau; Ig kappa chain V-I region Mev; Ig kappa chain V-I region OU; Ig kappa chain V-I region Walker
Synonym 2
NGK1; Voltage-gated K(+) channel HuKIV; Voltage-gated potassium channel HBK5; Voltage-gated potassium channel subunit Kv1.2
Sequence 1
MDMRVPAQLLGLLLLWLRGARCDIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQ
KPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTP

    Click to Show/Hide
Sequence 2
MTVATGDPADEAAALPGHPQDTYDPEADHECCERVVINISGLRFETQLKTLAQFPETLLG
DPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDIFSEEIRFYELGE
EAMEMFREDEGYIKEEERPLPENEFQRQVWLLFEYPESSGPARIIAIVSVMVILISIVSF
CLETLPIFRDENEDMHGSGVTFHTYSNSTIGYQQSTSFTDPFFIVETLCIIWFSFEFLVR
FFACPSKAGFFTNIMNIIDIVAIIPYFITLGTELAEKPEDAQQGQQAMSLAILRVIRLVR
VFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEADERESQFPS
IPDAFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRE
TEGEEQAQYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSNEDFREENLKTA
NCTLANTNYVNITKMLTDV

    Click to Show/Hide
Family2
the potassium channel family
Function 1
V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins- secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens. The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen.

    Click to Show/Hide
Function 2
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the cardiovascular system. Prevents aberrant action potential firing and regulates neuronal output. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, KCNA6, KCNA7, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation of delayed rectifier potassium channels. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA2 forms a delayed-rectifier potassium channel that opens in response to membrane depolarization, followed by slow spontaneous channel closure. In contrast, a heteromultimer formed by KCNA2 and KCNA4 shows rapid inactivation. Regulates neuronal excitability and plays a role as pacemaker in the regulation of neuronal action potentials. KCNA2- containing channels play a presynaptic role and prevent hyperexcitability and aberrant action potential firing. Response to toxins that are selective for KCNA2-containing potassium channels suggests that in Purkinje cells, dendritic subthreshold KCNA2- containing potassium channels prevent random spontaneous calcium spikes, suppressing dendritic hyperexcitability without hindering the generation of somatic action potentials, and thereby play an important role in motor coordination. Plays a role in the induction of long-term potentiation of neuron excitability in the CA3 layer of the hippocampus. May function as down-stream effector for G protein-coupled receptors and inhibit GABAergic inputs to basolateral amygdala neurons. May contribute to the regulation of neurotransmitter release, such as gamma-aminobutyric acid (GABA). Contributes to the regulation of the axonal release of the neurotransmitter dopamine. Reduced KCNA2 expression plays a role in the perception of neuropathic pain after peripheral nerve injury, but not acute pain. Plays a role in the regulation of the time spent in non-rapid eye movement (NREM) sleep.

    Click to Show/Hide
Taxonomy ID
9606
TCDB ID
. ; 1.A.1.2.10
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Bgk (W5Y,Y26F) Dissociation constant
9 pM
[1]
 Toxin Info    Potassium channel toxin Bgk (W5Y,F6A,Y26F) Dissociation constant
0.225 nM
[1]
 Toxin Info    Potassium channel toxin ShK (C3[Abu],C39[Abu]) Dissociation constant
24.2 nM
[2]
 Toxin Info    Kappa-stichotoxin-She3a Inhibition constant
0.03 nM
[3]
 Toxin Info    Kappa-stichotoxin-She3a Inhibition constant
0.08 nM
[3]
 Toxin Info    Potassium channel toxin alpha-KTx 1.1 Inhibition constant
0.318 nM
[1]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) Inhibition constant
0.35 nM
[3]
 Toxin Info    Potassium channel toxin ShK (K22[Dap]) Inhibition constant
0.35 nM
[3]
 Toxin Info    Kappa-actitoxin-Bgr1a Inhibition constant
8 nM
[1]
 Toxin Info    Kappa-conotoxin RIIIJ IC50
1.2 nM
[4]
 Toxin Info    Kappa-conotoxin RIIIJ IC50
12 nM
[5]
 Toxin Info    Kappa-conotoxin RIIIJ IC50
14.3 nM
[4]
 Toxin Info    Kappa-conotoxin RIIIJ IC50
18.4 nM
[4]
 Toxin Info    Kappa-conotoxin RIIIK IC50
2.8 μM
[5]
References
Ref 1 Characterization of a novel radiolabeled peptide selective for a subpopulation of voltage-gated potassium channels in mammalian brain. J Biol Chem. 2002 Feb 8;277(6):3886-93. doi: 10.1074/jbc.M109886200. Epub 2001 Nov 13.
Ref 2 Role of disulfide bonds in the structure and potassium channel blocking activity of ShK toxin. Biochemistry. 1999 Nov 2;38(44):14549-58. doi: 10.1021/bi991282m.
Ref 3 Substitution of a single residue in Stichodactyla helianthus peptide, ShK-Dap22, reveals a novel pharmacological profile. Biochemistry. 2003 Nov 25;42(46):13698-707. doi: 10.1021/bi035209e.
Ref 4 Conotoxin M-RIIIJ, a tool targeting asymmetric heteromeric K(v)1 channels. Proc Natl Acad Sci U S A. 2019 Jan 15;116(3):1059-1064. doi: 10.1073/pnas.1813161116. Epub 2018 Dec 28.
Ref 5 Biochemical characterization of kappaM-RIIIJ, a Kv1.2 channel blocker: evaluation of cardioprotective effects of kappaM-conotoxins. J Biol Chem. 2010 May 14;285(20):14882-14889. doi: 10.1074/jbc.M109.068486. Epub 2010 Mar 10.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.