Peptide Information
General Information of This Peptide
| Peptide ID |
BTDP004941
|
|||||
|---|---|---|---|---|---|---|
| Peptide Name |
Toxin GTx1-15
|
|||||
| Symonym |
Beta/omega-theraphotoxin-Gr2a; Toxin GpTx-1
|
|||||
| Species |
Grammostola porteri (Tarantula spider) (Lasiodora porteri)
|
|||||
| Uniprot Name | ||||||
| Alphafold ID | ||||||
| 3D Structure |
|
|||||
| Sequence |
DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF
Click to Show/Hide
|
|||||
| Sequence Length |
34
|
|||||
| Mass (Da) |
4081
|
|||||
| Sequence Removed Signal Peptide |
DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF
Click to Show/Hide
|
|||||
| Disulfide Bond |
2-17;9-23;16-30
|
|||||
| PDB ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Full List of Activity Data of This Peptide Toxin
| Target Name | Activity Data Type | Activity Data | Concentration | Note | Reference |
|---|---|---|---|---|---|
| Target Info Cav3.1 | Inhibition rate |
30 %
|
9.8 nM
|
Inhibition of the peak current
|
[1], [2] |
| Target Info Nav1.7 | IC50 |
0.58 - 10 nM
|
. |
Inhibition of the peak current
|
[1], [2] |
| Target Info Nav1.2 | IC50 |
5 - 128 nM
|
. |
Inhibition of the peak current
|
[1], [2] |
| Target Info Nav1.1 | IC50 |
6 nM
|
. |
Inhibition of the peak current
|
[1], [2] |
| Target Info Nav1.6 | IC50 |
17 - 20.1 nM
|
. |
Inhibition of the peak current
|
[1], [2] |
| Target Info Nav1.3 | IC50 |
20.3 - 170 nM
|
. |
Inhibition of the peak current
|
[1], [2] |
| Target Info Nav1.8 | IC50 |
0.068 - 12.2 μM
|
. |
Inhibition of the peak current
|
[1], [2] |
| Target Info Nav1.5 | IC50 |
0.14 - >10 μM
|
. |
Inhibition of the peak current
|
[1], [2] |
| Target Info Nav1.4 | IC50 |
0.2 - >10 μM
|
. |
Inhibition of the peak current
|
[1], [2] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
