Peptide Information

General Information of This Peptide
Peptide ID
BTDP005992
Peptide Name
Alpha-like toxin BmK M1
Symonym
BmK-I; BmK1
Species
Mesobuthus martensii (Manchurian scorpion) (Buthus martensii)
Uniprot Name
SCM1_MESMA
Alphafold ID
P45697
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1DJT
Sequence
MNYLVMISFALLLMTGVESVRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGK
YGNGCWCIELPDNVPIRVPGKCHR
   Click to Show/Hide
Sequence Length
84
Mass (Da)
9496
Signal Sequence
MNYLVMISFALLLMTGVES
   Click to Show/Hide
Sequence Removed Signal Peptide
VRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVP
GKCHR
   Click to Show/Hide
Disulfide Bond
31-82;35-55;41-65;45-67
PDB ID
1DJT , 1SN1 , 1T7A , 1T7B , 1T7E , 1ZU3 , 1ZUT , 1ZVE , 1ZVG , 1ZYV , 1ZYW
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Arthropoda
Class: Arachnida
Order: Scorpiones
Family: Buthidae
Genus: Mesobuthus
Species: Mesobuthus martensii
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Para/DmNav1 Effective concentration 50
30 nM
 . . [1- 14]
 Target Info    Nav1.2 Effective concentration 50
139 - 252 nM
 . . [1- 14]
 Target Info    Nav1.4 Effective concentration 50
195 - 500 nM
 . . [1- 14]
 Target Info    Nav1.5 Effective concentration 50
195 - 500 nM
 . . [1- 14]
 Target Info    Nav1.6 Effective concentration 50
214 nM
 . . [1- 14]
 Target Info    Nav1.3 Effective concentration 50
565 nM
 . . [1- 14]
References
Ref 1 The CDNA and genomic DNA sequences of a mammalian neurotoxin from the scorpion Buthus martensii Karsch. Toxicon. 1997 Jul;35(7):1025-31. doi: 10.1016/s0041-0101(96)00224-3.
Ref 2 Two neurotoxins (BmK I and BmK II) from the venom of the scorpion Buthus martensi Karsch: purification, amino acid sequences and assessment of specific activity. Toxicon. 1996 Sep;34(9):987-1001. doi: 10.1016/0041-0101(96)00065-7.
Ref 3 Electrophysiological characterization of BmK M1, an alpha-like toxin from Buthus martensi Karsch venom. FEBS Lett. 2001 Apr 20;495(1-2):61-5. doi: 10.1016/s0014-5793(01)02365-1.
Ref 4 Exploration of the functional site of a scorpion alpha-like toxin by site-directed mutagenesis. Biochemistry. 2003 Apr 29;42(16):4699-708. doi: 10.1021/bi0270438.
Ref 5 Importance of the conserved aromatic residues in the scorpion alpha-like toxin BmK M1: the hydrophobic surface region revisited. J Biol Chem. 2003 Jun 27;278(26):24125-31. doi: 10.1074/jbc.M211931200. Epub 2003 Apr 13.
Ref 6 Fos expression in rat spinal cord induced by peripheral injection of BmK I, an alpha-like scorpion neurotoxin. Toxicol Appl Pharmacol. 2003 Oct 1;192(1):78-85. doi: 10.1016/s0041-008x(03)00260-6.
Ref 7 Molecular basis of the mammalian potency of the scorpion alpha-like toxin, BmK M1. FASEB J. 2005 Apr;19(6):594-6. doi: 10.1096/fj.04-2485fje. Epub 2005 Jan 27.
Ref 8 The epileptic seizures induced by BmK I, a modulator of sodium channels. Exp Neurol. 2006 Jan;197(1):167-76. doi: 10.1016/j.expneurol.2005.09.006. Epub 2005 Oct 17.
Ref 9 The alpha-like scorpion toxin BmK I enhances membrane excitability via persistent sodium current by preventing slow inactivation and deactivation of rNav1.2a expressed in Xenopus Oocytes. Toxicol In Vitro. 2009 Jun;23(4):561-8. doi: 10.1016/j.tiv.2008.12.022. Epub 2008 Dec 30.
Ref 10 Molecular determination of selectivity of the site 3 modulator (BmK I) to sodium channels in the CNS: a clue to the importance of Nav1.6 in BmK I-induced neuronal hyperexcitability. Biochem J. 2010 Oct 15;431(2):289-98. doi: 10.1042/BJ20100517.
Ref 11 A series of bioactivity-variant neurotoxins from scorpion Buthus martensii Karsch: purification, crystallization and crystallographic analysis. Acta Crystallogr D Biol Crystallogr. 1999 Jan;55(Pt 1):341-4. doi: 10.1107/S0907444998006593. Epub 1999 Jan 1.
Ref 12 Crystal structures of two alpha-like scorpion toxins: non-proline cis peptide bonds and implications for new binding site selectivity on the sodium channel. J Mol Biol. 1999 Sep 10;292(1):125-35. doi: 10.1006/jmbi.1999.3036.
Ref 13 Structural mechanism governing cis and trans isomeric states and an intramolecular switch for cis/trans isomerization of a non-proline peptide bond observed in crystal structures of scorpion toxins. J Mol Biol. 2004 Aug 27;341(5):1189-204. doi: 10.1016/j.jmb.2004.06.067.
Ref 14 Structural basis for the voltage-gated Na+ channel selectivity of the scorpion alpha-like toxin BmK M1. J Mol Biol. 2005 Nov 4;353(4):788-803. doi: 10.1016/j.jmb.2005.08.068. Epub 2005 Sep 22.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.