Peptide Information

General Information of This Peptide
Peptide ID
BTDP004014
Peptide Name
Beta-mammal toxin Css2
Symonym
Css II
Species
Centruroides suffusus (Durango bark scorpion)
Uniprot Name
SCX2_CENSU
Alphafold ID
P08900
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 2LI7
Sequence
KEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPL
PNKTCN
   Click to Show/Hide
Sequence Length
66
Mass (Da)
7547
Sequence Removed Signal Peptide
KEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPL
PNKTCN
   Click to Show/Hide
Disulfide Bond
12-65;16-41;25-46;29-48
PDB ID
2LI7 , 2LJM
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Arthropoda
Class: Arachnida
Order: Scorpiones
Family: Buthidae
Genus: Centruroides
Species: Centruroides suffusus
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Nav1.1 Inhibition rate .
280 nM
Inhibition of the peak current
 [1- 10]
 Target Info    Nav1.2 Inhibition rate .
280 nM
Inhibition of the peak current
 [1- 10]
 Target Info    Nav1.3 Inhibition rate .
280 nM
Inhibition of the peak current
 [1- 10]
 Target Info    Nav1.4 Inhibition rate .
280 nM
Inhibition of the peak current
 [1- 10]
 Target Info    Nav1.5 Inhibition rate .
280 nM
Inhibition of the peak current
 [1- 10]
 Target Info    Nav1.7 Inhibition rate .
280 nM
Inhibition of the peak current
 [1- 10]
 Target Info    Nav1.5 IC50
35 - 40 nM
 .
Reduce peak current
 [1- 10]
 Target Info    tetrodotoxin (TTX)-sensitive sodium channel IC50
307 nM
 .
Reduce peak current,site4
 [1- 10]
References
Ref 1 Purification and chemical and biological characterizations of seven toxins from the Mexican scorpion, Centruroides suffusus suffusus. J Biol Chem. 1987 Apr 5;262(10):4452-9.
Ref 2 Expression of functional recombinant scorpion beta-neurotoxin Css II in E. coli. Peptides. 2000 Jun;21(6):767-72. doi: 10.1016/s0196-9781(00)00206-0.
Ref 3 Four disulfide-bridged scorpion beta neurotoxin CssII: heterologous expression and proper folding in vitro. Biochim Biophys Acta. 2007 Aug;1770(8):1161-8. doi: 10.1016/j.bbagen.2007.04.006. Epub 2007 May 1.
Ref 4 Isolation and molecular cloning of beta-neurotoxins from the venom of the scorpion Centruroides suffusus suffusus. Toxicon. 2011 Apr;57(5):739-46. doi: 10.1016/j.toxicon.2011.02.006. Epub 2011 Feb 15.
Ref 5 Heterologous expressed toxic and non-toxic peptide variants of toxin CssII are capable to produce neutralizing antibodies against the venom of the scorpion Centruroides suffusus suffusus. Immunol Lett. 2009 Aug 15;125(2):93-9. doi: 10.1016/j.imlet.2009.06.001. Epub 2009 Jun 12.
Ref 6 Differential phospholipid binding by site 3 and site 4 toxins. Implications for structural variability between voltage-sensitive sodium channel domains. J Biol Chem. 2005 Mar 25;280(12):11127-33. doi: 10.1074/jbc.M412552200. Epub 2005 Jan 4.
Ref 7 Addition of positive charges at the C-terminal peptide region of CssII, a mammalian scorpion peptide toxin, improves its affinity for sodium channels Nav1.6. Peptides. 2011 Jan;32(1):75-9. doi: 10.1016/j.peptides.2010.11.001. Epub 2010 Nov 13.
Ref 8 Negative-shift activation, current reduction and resurgent currents induced by -toxins from Centruroides scorpions in sodium channels. Toxicon. 2012 Feb;59(2):283-93. doi: 10.1016/j.toxicon.2011.12.003. Epub 2011 Dec 16.
Ref 9 Generation of a Broadly Cross-Neutralizing Antibody Fragment against Several Mexican Scorpion Venoms. Toxins (Basel). 2019 Jan 10;11(1):32. doi: 10.3390/toxins11010032.
Ref 10 Solution structure of native and recombinant expressed toxin CssII from the venom of the scorpion Centruroides suffusus suffusus, and their effects on Nav1.5 sodium channels. Biochim Biophys Acta. 2012 Mar;1824(3):478-87. doi: 10.1016/j.bbapap.2012.01.003. Epub 2012 Jan 11.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.