Peptide Information

General Information of This Peptide
Peptide ID
BTDP003971
Peptide Name
Delta-actitoxin-Avd1c
Symonym
ATX-II; Anemonia sulcata toxin 2; Neurotoxin 2; Toxin II
Species
Anemonia sulcata (Mediterranean snakelocks sea anemone)
Uniprot Name
NA12_ANESU
Alphafold ID
P01528
3D Structure
Download
2D Sequence
3D Structure
Source
Alphafold db: P01528
Sequence
GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
   Click to Show/Hide
Sequence Length
47
Mass (Da)
4941
Sequence Removed Signal Peptide
GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
   Click to Show/Hide
Disulfide Bond
4-44;6-34;27-45
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Cnidaria
Class: Anthozoa
Order: Actiniaria
Family: Actiniidae
Genus: Anemonia
Species: Anemonia sulcata
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Nav1.6 Effective concentration 50
˜180 nM
 .
Delay Nav inactivation
 [1- 7]
 Target Info    Nav1.2 Effective concentration 50
7.88 nM
 .
Delay Nav inactivation
 [1- 7]
 Target Info    Nav1.5 Effective concentration 50
49.05 nM
 .
Delay Nav inactivation
 [1- 7]
 Target Info    Nav1.4 Effective concentration 50
109.49 nM
 .
Delay Nav inactivation
 [1- 7]
 Target Info    Nav1.3 Effective concentration 50
759.22 nM
 .
Delay Nav inactivation
 [1- 7]
References
Ref 1 Amino-acid sequence of a coelenterate toxin: toxin II from Anemonia sulcata. Eur J Biochem. 1976 Sep;68(1):193-8. doi: 10.1111/j.1432-1033.1976.tb10778.x.
Ref 2 [The disulfide bridges of toxin II from Anemonia sulcata (author's transl)]. Hoppe Seylers Z Physiol Chem. 1978 Sep;359(9):1193-201.
Ref 3 Anemonia sulcata toxins modify activation and inactivation of Na+ currents in a crayfish neurone. Pflugers Arch. 1985 May;404(2):119-25. doi: 10.1007/BF00585406.
Ref 4 Sea anemone toxin (ATX II) modulation of heart and skeletal muscle sodium channel alpha-subunits expressed in tsA201 cells. J Membr Biol. 1996 Jul;152(1):39-48. doi: 10.1007/s002329900083.
Ref 5 Functional expression of Drosophila para sodium channels. Modulation by the membrane protein TipE and toxin pharmacology. J Gen Physiol. 1997 Aug;110(2):119-33. doi: 10.1085/jgp.110.2.119.
Ref 6 Binding specificity of sea anemone toxins to Nav 1.1-1.6 sodium channels: unexpected contributions from differences in the IV/S3-S4 outer loop. J Biol Chem. 2004 Aug 6;279(32):33323-35. doi: 10.1074/jbc.M404344200. Epub 2004 May 28.
Ref 7 Development of a rational nomenclature for naming peptide and protein toxins from sea anemones. Toxicon. 2012 Sep 15;60(4):539-50. doi: 10.1016/j.toxicon.2012.05.020. Epub 2012 Jun 5.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.