General Information of This Target
Target ID
BTDT00116
Target Name
Acid-sensing ion channel 1 (ASIC1)
Target Bioclass
Transporter and channel
Uniprot ID
P78348
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
ASIC1
Gene ID
41
Synonym
ACCN2; BNAC2; Amiloride-sensitive cation channel 2, neuronal; Brain sodium channel 2
Sequence
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS
AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLD
FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY
CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA
DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC

    Click to Show/Hide
Family
the amiloride-sensitive sodium channel family
Function
Isoform 2 and isoform 3 function as proton-gated sodium channels; they are activated by a drop of the extracellular pH and then become rapidly desensitized. The channel generates a biphasic current with a fast inactivating and a slow sustained phase. Has high selectivity for sodium ions and can also transport lithium ions with high efficiency. Isoform 2 can also transport potassium, but with lower efficiency. It is nearly impermeable to the larger rubidium and cesium ions. Isoform 3 can also transport calcium ions. Mediates glutamate- independent Ca(2+) entry into neurons upon acidosis. This Ca(2+) overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Functions as a postsynaptic proton receptor that influences intracellular Ca(2+) concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. Modulates activity in the circuits underlying innate fear. Isoform 1 does not display proton-gated cation channel activity.

    Click to Show/Hide
Taxonomy ID
9606
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Hi1a Tau(off)
31.8 min
[1], [2]
 Toxin Info    Pi-theraphotoxin-Hm3a Effective concentration 50
178.1 nM
[3]
 Toxin Info    PcTX1 IC50
0.35 - 3.8 nM
[1- 18]
 Toxin Info    Hi1a IC50
0.52 nM
[1], [2]
 Toxin Info    Pi-theraphotoxin-Hm3a IC50
39.7 nM
[3]
 Toxin Info    Mambalgin-1 IC50
127 - 580 nM
[19- 25]
References
Ref 1 Potent neuroprotection after stroke afforded by a double-knot spider-venom peptide that inhibits acid-sensing ion channel 1a. Proc Natl Acad Sci U S A. 2017 Apr 4;114(14):3750-3755. doi: 10.1073/pnas.1614728114. Epub 2017 Mar 20.
Ref 2 The antitrypanosomal diarylamidines, diminazene and pentamidine, show anthelmintic activity against Haemonchus contortus in vitro. Vet Parasitol. 2019 Jun;270:40-46. doi: 10.1016/j.vetpar.2019.05.008. Epub 2019 May 19.
Ref 3 Discovery and molecular interaction studies of a highly stable, tarantula peptide modulator of acid-sensing ion channel 1. Neuropharmacology. 2017 Dec;127:185-195. doi: 10.1016/j.neuropharm.2017.03.020. Epub 2017 Mar 19.
Ref 4 Isolation of a tarantula toxin specific for a class of proton-gated Na+ channels. J Biol Chem. 2000 Aug 18;275(33):25116-21. doi: 10.1074/jbc.M003643200.
Ref 5 The tarantula toxin psalmotoxin 1 inhibits acid-sensing ion channel (ASIC) 1a by increasing its apparent H+ affinity. J Gen Physiol. 2005 Jul;126(1):71-9. doi: 10.1085/jgp.200509303. Epub 2005 Jun 13.
Ref 6 Interaction of acid-sensing ion channel (ASIC) 1 with the tarantula toxin psalmotoxin 1 is state dependent. J Gen Physiol. 2006 Mar;127(3):267-76. doi: 10.1085/jgp.200509409. Epub 2006 Feb 14.
Ref 7 Native and recombinant ASIC1a receptors conduct negligible Ca2+ entry. Cell Calcium. 2009 Apr;45(4):319-25. doi: 10.1016/j.ceca.2008.12.002. Epub 2009 Jan 29.
Ref 8 Identification of a calcium permeable human acid-sensing ion channel 1 transcript variant. J Biol Chem. 2010 Dec 31;285(53):41852-62. doi: 10.1074/jbc.M110.171330. Epub 2010 Oct 29.
Ref 9 Heteromeric acid-sensing ion channels (ASICs) composed of ASIC2b and ASIC1a display novel channel properties and contribute to acidosis-induced neuronal death. J Neurosci. 2011 Jun 29;31(26):9723-34. doi: 10.1523/JNEUROSCI.1665-11.2011.
Ref 10 Protons and Psalmotoxin-1 reveal nonproton ligand stimulatory sites in chicken acid-sensing ion channel: Implication for simultaneous modulation in ASICs. Channels (Austin). 2014;8(1):49-61. doi: 10.4161/chan.26978. Epub 2013 Nov 21.
Ref 11 Molecular dynamics and functional studies define a hot spot of crystal contacts essential for PcTx1 inhibition of acid-sensing ion channel 1a. Br J Pharmacol. 2015 Oct;172(20):4985-95. doi: 10.1111/bph.13267. Epub 2015 Sep 22.
Ref 12 PcTx1 affords neuroprotection in a conscious model of stroke in hypertensive rats via selective inhibition of ASIC1a. Neuropharmacology. 2015 Dec;99:650-7. doi: 10.1016/j.neuropharm.2015.08.040. Epub 2015 Aug 29.
Ref 13 Functional and pharmacological characterization of two different ASIC1a/2a heteromers reveals their sensitivity to the spider toxin PcTx1. Sci Rep. 2016 Jun 9;6:27647. doi: 10.1038/srep27647.
Ref 14 Acid-sensing ion channel (ASIC) structure and function: Insights from spider, snake and sea anemone venoms. Neuropharmacology. 2017 Dec;127:173-184. doi: 10.1016/j.neuropharm.2017.04.042. Epub 2017 Apr 27.
Ref 15 Recombinant production and solution structure of PcTx1, the specific peptide inhibitor of ASIC1a proton-gated cation channels. Protein Sci. 2003 Jul;12(7):1332-43. doi: 10.1110/ps.0307003.
Ref 16 A dynamic pharmacophore drives the interaction between Psalmotoxin-1 and the putative drug target acid-sensing ion channel 1a. Mol Pharmacol. 2011 Nov;80(5):796-808. doi: 10.1124/mol.111.072207. Epub 2011 Aug 8.
Ref 17 Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes. Nature. 2012 Sep 20;489(7416):400-5. doi: 10.1038/nature11375. Epub 2012 Jul 29.
Ref 18 Structure of the acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1. Nat Commun. 2012 Jul 3;3:936. doi: 10.1038/ncomms1917.
Ref 19 Black mamba venom peptides target acid-sensing ion channels to abolish pain. Nature. 2012 Oct 25;490(7421):552-5. doi: 10.1038/nature11494. Epub 2012 Oct 3.
Ref 20 Venom toxins in the exploration of molecular, physiological and pathophysiological functions of acid-sensing ion channels. Toxicon. 2013 Dec 1;75:187-204. doi: 10.1016/j.toxicon.2013.04.008. Epub 2013 Apr 26.
Ref 21 Site-specific fluorescence spectrum detection and characterization of hASIC1a channels upon toxin mambalgin-1 binding in live mammalian cells. Chem Commun (Camb). 2015 May 11;51(38):8153-6. doi: 10.1039/c5cc01418b. Epub 2015 Apr 15.
Ref 22 Analgesic effects of mambalgin peptide inhibitors of acid-sensing ion channels in inflammatory and neuropathic pain. Pain. 2016 Mar;157(3):552-559. doi: 10.1097/j.pain.0000000000000397.
Ref 23 One-pot hydrazide-based native chemical ligation for efficient chemical synthesis and structure determination of toxin Mambalgin-1. Chem Commun (Camb). 2014 Jun 4;50(44):5837-9. doi: 10.1039/c4cc00779d.
Ref 24 Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition. J Biol Chem. 2016 Feb 5;291(6):2616-29. doi: 10.1074/jbc.M115.702373. Epub 2015 Dec 17.
Ref 25 Cryo-EM structure of the ASIC1a-mambalgin-1 complex reveals that the peptide toxin mambalgin-1 inhibits acid-sensing ion channels through an unusual allosteric effect. Cell Discov. 2018 Jun 5;4:27. doi: 10.1038/s41421-018-0026-1. eCollection 2018.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.