Target Information
General Information of This Target
| Target ID |
BTDT00116
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Acid-sensing ion channel 1 (ASIC1)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
ASIC1
|
|||||
| Gene ID | ||||||
| Synonym |
ACCN2; BNAC2; Amiloride-sensitive cation channel 2, neuronal; Brain sodium channel 2
|
|||||
| Sequence |
MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCS AEDFKVVFTRYGKCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMDSDLD FFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEY CVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSA DKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC Click to Show/Hide
|
|||||
| Family |
the amiloride-sensitive sodium channel family
|
|||||
| Function |
Isoform 2 and isoform 3 function as proton-gated sodium channels; they are activated by a drop of the extracellular pH and then become rapidly desensitized. The channel generates a biphasic current with a fast inactivating and a slow sustained phase. Has high selectivity for sodium ions and can also transport lithium ions with high efficiency. Isoform 2 can also transport potassium, but with lower efficiency. It is nearly impermeable to the larger rubidium and cesium ions. Isoform 3 can also transport calcium ions. Mediates glutamate- independent Ca(2+) entry into neurons upon acidosis. This Ca(2+) overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Functions as a postsynaptic proton receptor that influences intracellular Ca(2+) concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. Modulates activity in the circuits underlying innate fear. Isoform 1 does not display proton-gated cation channel activity.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Hi1a | Tau(off) |
31.8 min
|
[1], [2] |
| Toxin Info Pi-theraphotoxin-Hm3a | Effective concentration 50 |
178.1 nM
|
[3] |
| Toxin Info PcTX1 | IC50 |
0.35 - 3.8 nM
|
[1- 18] |
| Toxin Info Hi1a | IC50 |
0.52 nM
|
[1], [2] |
| Toxin Info Pi-theraphotoxin-Hm3a | IC50 |
39.7 nM
|
[3] |
| Toxin Info Mambalgin-1 | IC50 |
127 - 580 nM
|
[19- 25] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
