Peptide Information

General Information of This Peptide
Peptide ID
BTDP006221
Peptide Name
PcTX1
Symonym
PcTx1; Pi-theraphotoxin-Pc1a;Psalmotoxin-1
Species
Psalmopoeus cambridgei (Trinidad chevron tarantula)
Uniprot Name
TXP1_PSACA
Alphafold ID
P60514
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1LMM
Sequence
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
   Click to Show/Hide
Sequence Length
40
Mass (Da)
4695
Sequence Removed Signal Peptide
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
   Click to Show/Hide
Disulfide Bond
3-18;10-23;17-33
PDB ID
1LMM , 2KNI , 3S3X , 4FZ0 , 4FZ1
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Arthropoda
Class: Arachnida
Order: Araneae
Family: Theraphosidae
Genus: Psalmopoeus
Species: Psalmopoeus cambridgei
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    acid-sensing ion channel (ASIC) IC50
0.35 - 3.7 nM
 . . [1- 16]
 Target Info    ASIC1b IC50
0.35 - 3.8 nM
 . . [1- 16]
 Target Info    ASIC1a IC50
0.35 - 3.9 nM
 . . [1- 16]
 Target Info    ASIC1a-ASIC2b IC50
2.64 nM
 . . [1- 16]
References
Ref 1 Isolation of a tarantula toxin specific for a class of proton-gated Na+ channels. J Biol Chem. 2000 Aug 18;275(33):25116-21. doi: 10.1074/jbc.M003643200.
Ref 2 The tarantula toxin psalmotoxin 1 inhibits acid-sensing ion channel (ASIC) 1a by increasing its apparent H+ affinity. J Gen Physiol. 2005 Jul;126(1):71-9. doi: 10.1085/jgp.200509303. Epub 2005 Jun 13.
Ref 3 Interaction of acid-sensing ion channel (ASIC) 1 with the tarantula toxin psalmotoxin 1 is state dependent. J Gen Physiol. 2006 Mar;127(3):267-76. doi: 10.1085/jgp.200509409. Epub 2006 Feb 14.
Ref 4 Native and recombinant ASIC1a receptors conduct negligible Ca2+ entry. Cell Calcium. 2009 Apr;45(4):319-25. doi: 10.1016/j.ceca.2008.12.002. Epub 2009 Jan 29.
Ref 5 Identification of a calcium permeable human acid-sensing ion channel 1 transcript variant. J Biol Chem. 2010 Dec 31;285(53):41852-62. doi: 10.1074/jbc.M110.171330. Epub 2010 Oct 29.
Ref 6 Heteromeric acid-sensing ion channels (ASICs) composed of ASIC2b and ASIC1a display novel channel properties and contribute to acidosis-induced neuronal death. J Neurosci. 2011 Jun 29;31(26):9723-34. doi: 10.1523/JNEUROSCI.1665-11.2011.
Ref 7 Protons and Psalmotoxin-1 reveal nonproton ligand stimulatory sites in chicken acid-sensing ion channel: Implication for simultaneous modulation in ASICs. Channels (Austin). 2014;8(1):49-61. doi: 10.4161/chan.26978. Epub 2013 Nov 21.
Ref 8 Molecular dynamics and functional studies define a hot spot of crystal contacts essential for PcTx1 inhibition of acid-sensing ion channel 1a. Br J Pharmacol. 2015 Oct;172(20):4985-95. doi: 10.1111/bph.13267. Epub 2015 Sep 22.
Ref 9 PcTx1 affords neuroprotection in a conscious model of stroke in hypertensive rats via selective inhibition of ASIC1a. Neuropharmacology. 2015 Dec;99:650-7. doi: 10.1016/j.neuropharm.2015.08.040. Epub 2015 Aug 29.
Ref 10 Functional and pharmacological characterization of two different ASIC1a/2a heteromers reveals their sensitivity to the spider toxin PcTx1. Sci Rep. 2016 Jun 9;6:27647. doi: 10.1038/srep27647.
Ref 11 Potent neuroprotection after stroke afforded by a double-knot spider-venom peptide that inhibits acid-sensing ion channel 1a. Proc Natl Acad Sci U S A. 2017 Apr 4;114(14):3750-3755. doi: 10.1073/pnas.1614728114. Epub 2017 Mar 20.
Ref 12 Acid-sensing ion channel (ASIC) structure and function: Insights from spider, snake and sea anemone venoms. Neuropharmacology. 2017 Dec;127:173-184. doi: 10.1016/j.neuropharm.2017.04.042. Epub 2017 Apr 27.
Ref 13 Recombinant production and solution structure of PcTx1, the specific peptide inhibitor of ASIC1a proton-gated cation channels. Protein Sci. 2003 Jul;12(7):1332-43. doi: 10.1110/ps.0307003.
Ref 14 A dynamic pharmacophore drives the interaction between Psalmotoxin-1 and the putative drug target acid-sensing ion channel 1a. Mol Pharmacol. 2011 Nov;80(5):796-808. doi: 10.1124/mol.111.072207. Epub 2011 Aug 8.
Ref 15 Structural plasticity and dynamic selectivity of acid-sensing ion channel-spider toxin complexes. Nature. 2012 Sep 20;489(7416):400-5. doi: 10.1038/nature11375. Epub 2012 Jul 29.
Ref 16 Structure of the acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1. Nat Commun. 2012 Jul 3;3:936. doi: 10.1038/ncomms1917.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.