General Information of This Target
Target ID
BTDT00224
Target Name
Acid-sensing ion channel 1 (Asic1);Acid-sensing ion channel 2 (Asic2)
Target Bioclass
Transporter and channel
Uniprot ID
P55926 ; Q62962
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
Asic1;Asic2
Gene ID
79123 ; 25364
Synonym 1
Accn2; Bnac2; Amiloride-sensitive cation channel 2, neuronal; Brain sodium channel 2
Synonym 2
Amiloride-sensitive brain sodium channel; Amiloride-sensitive brain sodium channel 2; Amiloride-sensitive cation channel 1, neuronal; Amiloride-sensitive cation channel neuronal 1; Brain sodium channel 1; Mammalian degenerin homolog
Sequence 1
MELKTEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCV
CTERVQYYFCYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNN
RYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEACS
AEDFKVVFTRYGKCYTFNSGQDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETS
FEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLIYLPSPWGTCNAVTMDSDFF
DSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCV
CEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQ
KKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCQKEAKRSSADK
GVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC

    Click to Show/Hide
Sequence 2
MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVES
SERVSYYFSYQHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVN
LQIPDPHLADPTVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGH
QDFTTVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTF
EAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFP
VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLC
RTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK
KAYEVAALLGDIGGQMGLFIGASLLTILELFDYIYELIKEKLLDLLGKEEEEGSHDENMS
TCDTMPNHSETISHTVNVPLQTALGTLEEIAC

    Click to Show/Hide
Family1
the amiloride-sensitive sodium channel family
Family2
the amiloride-sensitive sodium channel (TC 1.A.6) family
Function 1
Proton-gated sodium channel; it is activated by a drop of the extracellular pH and then becomes rapidly desensitized. Generates a biphasic current with a fast inactivating and a slow sustained phase. Has high selectivity for sodium ions and can also transport lithium ions with high efficiency. Can also transport potassium ions, but with lower efficiency. It is nearly impermeable to the larger rubidium and cesium ions. Isoform 3 discrimates stronger than isoform 1 between monovalent cations. Isoform 3 can flux Ca(2+) while isoform 1 cannot. Heteromeric channels composed of isoform 2 and isoform 3 are active but have a lower pH-sensitivity. Mediates glutamate-independent Ca(2+) entry into neurons upon acidosis. This Ca(2+) overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties.

    Click to Show/Hide
Function 2
Cation channel with high affinity for sodium, which is gated; by extracellular protons and inhibited by the diuretic amiloride. Also; permeable for Li(+) and K(+). Activation by an extracellular pH drop is; followed by a rapid pH-independent inactivation. Heteromeric channel; assembly seems to modulate channel properties.

    Click to Show/Hide
Taxonomy ID
10116
TCDB ID
1.A.6.1.2 ; 1.A.6.1.2
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Rodentia
Family: Muridae
Genus: Rattus
Species: Rattus norvegicus
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Mambalgin-1 IC50
61 nM
[1- 7]
 Toxin Info    Mambalgin-2 IC50
61 nM
[1- 10]
 Toxin Info    Mambalgin-1 IC50
152 - 252 nM
[1- 7]
 Toxin Info    Mambalgin-2 IC50
246 - 252 nM
[1- 10]
 Toxin Info    Mambalgin-3 IC50
252 nM
[2]
References
Ref 1 Black mamba venom peptides target acid-sensing ion channels to abolish pain. Nature. 2012 Oct 25;490(7421):552-5. doi: 10.1038/nature11494. Epub 2012 Oct 3.
Ref 2 Venom toxins in the exploration of molecular, physiological and pathophysiological functions of acid-sensing ion channels. Toxicon. 2013 Dec 1;75:187-204. doi: 10.1016/j.toxicon.2013.04.008. Epub 2013 Apr 26.
Ref 3 Site-specific fluorescence spectrum detection and characterization of hASIC1a channels upon toxin mambalgin-1 binding in live mammalian cells. Chem Commun (Camb). 2015 May 11;51(38):8153-6. doi: 10.1039/c5cc01418b. Epub 2015 Apr 15.
Ref 4 Analgesic effects of mambalgin peptide inhibitors of acid-sensing ion channels in inflammatory and neuropathic pain. Pain. 2016 Mar;157(3):552-559. doi: 10.1097/j.pain.0000000000000397.
Ref 5 One-pot hydrazide-based native chemical ligation for efficient chemical synthesis and structure determination of toxin Mambalgin-1. Chem Commun (Camb). 2014 Jun 4;50(44):5837-9. doi: 10.1039/c4cc00779d.
Ref 6 Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition. J Biol Chem. 2016 Feb 5;291(6):2616-29. doi: 10.1074/jbc.M115.702373. Epub 2015 Dec 17.
Ref 7 Cryo-EM structure of the ASIC1a-mambalgin-1 complex reveals that the peptide toxin mambalgin-1 inhibits acid-sensing ion channels through an unusual allosteric effect. Cell Discov. 2018 Jun 5;4:27. doi: 10.1038/s41421-018-0026-1. eCollection 2018.
Ref 8 Binding site and inhibitory mechanism of the mambalgin-2 pain-relieving peptide on acid-sensing ion channel 1a. J Biol Chem. 2014 May 9;289(19):13363-73. doi: 10.1074/jbc.M114.561076. Epub 2014 Apr 2.
Ref 9 Total synthesis of mambalgin-1/2/3 by two-segment hydrazide-based native chemical ligation. J Pept Sci. 2016 May;22(5):320-6. doi: 10.1002/psc.2868. Epub 2016 Mar 15.
Ref 10 Chemical synthesis, 3D structure, and ASIC binding site of the toxin mambalgin-2. Angew Chem Int Ed Engl. 2014 Jan 20;53(4):1017-20. doi: 10.1002/anie.201308898. Epub 2013 Dec 9.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.