Target Information
General Information of This Target
| Target ID |
BTDT00147
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Potassium voltage-gated channel subfamily A member 4 (Kcna4)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
Kcna4
|
|||||
| Gene ID | ||||||
| Synonym |
Voltage-gated potassium channel subunit Kv1.4
|
|||||
| Sequence |
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGTGGSGGG
PHHHHQTRGAYSSHDPQGSRGSRRRRRQRTEKKKLHHRQSSFPHCSDLMPSGSEEKILRE LSEEEEDEEEEEEEEEEGRFYYSEEDHGDGCSYTDLLPQDDGGGGGYSSVRYSDCCERVV INVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGG RLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEY PESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSAGGHSRLLNDTSAPHL ENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITL GTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELG LLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKI VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRS STSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDESETDKNNCSNAKAVETDV Click to Show/Hide
|
|||||
| Family |
the potassium channel family
|
|||||
| Function |
Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium- selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA5, and possibly other family members as well; channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes, making it difficult to assign currents observed in intact tissues to any particular potassium channel family member. Homotetrameric KCNA4 forms a potassium channel that opens in response to membrane depolarization, followed by rapid spontaneous channel closure. Likewise, a heterotetrameric channel formed by KCNA1 and KCNA4 shows rapid inactivation.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Kappa-theraphotoxin-Sc1a | Inhibition rate |
4 %
|
[1] |
| Toxin Info Delta-theraphotoxin-Hm1a | Inhibition rate |
4 %
|
[1], [2], [3], [4] |
| Toxin Info Potassium channel toxin ShK ([Pmp][AEEA],Q16K,M21[Nle]) | Inhibition rate |
5 %
|
[5] |
| Toxin Info Kappa-theraphotoxin-Hm2a | Inhibition rate |
6 %
|
[1] |
| Toxin Info Potassium channel toxin ShK (Q16K) | Inhibition rate |
15 %
|
[5] |
| Toxin Info Potassium channel toxin ShK (Q16K,M21I) | Inhibition rate |
15 %
|
[5] |
| Toxin Info Potassium channel toxin ShK ([Pmp][AEEA],Q16K) | Inhibition rate |
20 %
|
[5] |
| Toxin Info Kappa-stichotoxin-She3a | IC50 |
0.312 nM
|
[6] |
| Toxin Info Potassium channel toxin ShK (K22[Dap]) | IC50 |
37 nM
|
[6] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
