Target Information
General Information of This Target
| Target ID |
BTDT00138
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
ATP-sensitive inward rectifier potassium channel 11 (KCNJ11)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
KCNJ11
|
|||||
| Gene ID | ||||||
| Synonym |
IKATP; Inward rectifier K(+) channel Kir6.2; Potassium channel, inwardly rectifying subfamily J member 11
|
|||||
| Sequence |
MLSRKGIIPEEYVLTRLAEDPAKPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALT LASARGPLRKRSVPMAKAKPKFSISPDSLS Click to Show/Hide
|
|||||
| Family |
the inward rectifier-type potassium channel family
|
|||||
| Function |
This receptor is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium. Subunit of ATP-sensitive potassium channels (KATP). Can form cardiac and smooth muscle-type KATP channels with ABCC9. KCNJ11 forms the channel pore while ABCC9 is required for activation and regulation.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| TCDB ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Kappa-scoloptoxin(15)-Ssd3a | Dissociation constant |
118 nM
|
[1] |
| Toxin Info Toxin SSD893 | Dissociation constant |
123 nM
|
[1] |
| Toxin Info Omega-scoloptoxin(15)-Ssd3c | Dissociation constant |
126 nM
|
[1] |
| Toxin Info Mu-scoloptoxin(15)-Ssm1a | Dissociation constant |
180 nM
|
[2] |
| Toxin Info Toxin SSD893 | Dissociation constant |
260 nM
|
[1] |
| Toxin Info Omega-scoloptoxin(15)-Ssd3c | Dissociation constant |
278 nM
|
[1] |
| Toxin Info Kappa-scoloptoxin(15)-Ssd3a | Dissociation constant |
283 nM
|
[1] |
| Toxin Info SsTx-4 (Y16A) | IC50 |
1.8 nM
|
[3] |
| Toxin Info SsTx-4 (Y49A) | IC50 |
4.1 nM
|
[3] |
| Toxin Info SsTx-4 | IC50 |
8.2 nM
|
[3] |
| Toxin Info SsTx-4 (K10A) | IC50 |
9 nM
|
[3] |
| Toxin Info SsTx-4 (P8A) | IC50 |
9 nM
|
[3] |
| Toxin Info SsTx-4 (P15A) | IC50 |
9.7 nM
|
[3] |
| Toxin Info Ssm spooky toxin (K40A,K45A) | IC50 |
10 nM
|
[3] |
| Toxin Info SsTx-4 (P41A) | IC50 |
10 nM
|
[3] |
| Toxin Info SsTx-4 (K11A) | IC50 |
10.8 nM
|
[3] |
| Toxin Info SsTx-4 (F9A) | IC50 |
20.5 nM
|
[3] |
| Toxin Info SsTx-4 (K40A) | IC50 |
20.5 nM
|
[3] |
| Toxin Info SsTx-4 (R12A) | IC50 |
25.6 nM
|
[3] |
| Toxin Info SsTx-4 (K4A) | IC50 |
41 nM
|
[3] |
| Toxin Info SsTx-4 | IC50 |
42.5 nM
|
[3] |
| Toxin Info SsTx-4 (K45A) | IC50 |
49.2 nM
|
[3] |
| Toxin Info SsTx-4 (F43A) | IC50 |
65.6 nM
|
[3] |
| Toxin Info SsTx-4 (K4A,K40A) | IC50 |
73.8 nM
|
[3] |
| Toxin Info SsTx-4 (K4A,K45A) | IC50 |
90.2 nM
|
[3] |
| Toxin Info SsTx-4 (F44A) | IC50 |
131.2 nM
|
[3] |
| Toxin Info SsTx-4 (K40A,K45A) | IC50 |
155.8 nM
|
[3] |
| Toxin Info SsTx-4 (F14A) | IC50 |
172.2 nM
|
[3] |
| Toxin Info SsTx-4 (K4A,K40A,K45A) | IC50 |
319.8 nM
|
[3] |
| Toxin Info SsTx-4 (K13A) | IC50 |
434.6 nM
|
[3] |
| Toxin Info SsTx-4 (F43A,F44A) | IC50 |
951.2 nM
|
[3] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.