Target Information
General Information of This Target
| Target ID |
BTDT00098
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Caveolin-2 (CAV2)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
CAV2
|
|||||
| Gene ID | ||||||
| Sequence |
MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEP
VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD Click to Show/Hide
|
|||||
| Family |
the caveolin family
|
|||||
| Function |
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| TCDB ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Conotoxin Vr3a | Inhibition rate |
12.86 %
|
[1], [2] |
| Toxin Info Omega-conotoxin MoVIA | IC50 |
330 nM
|
[3] |
| Toxin Info Omega-theraphotoxin-Avsp1a | IC50 |
>25 μM
|
[4] |
| Toxin Info Beta-theraphotoxin-Cd1a | IC50 |
˜3 μM
|
[5] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
