General Information of This Peptide
Peptide ID
BTDP006223
Peptide Name
Alpha-bungarotoxin
Symonym
Alpha-bungarotoxin, isoform A31; Alpha-elapitoxin-Bm2a; Long neurotoxin 1
Species
Bungarus multicinctus (Many-banded krait)
Uniprot Name
3L21A_BUNMU
Alphafold ID
P60615
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1ABT
Sequence
MKTLLLTLVVVTIVCLDLGYTIVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKV
VELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
   Click to Show/Hide
Sequence Length
95
Mass (Da)
10285
Signal Sequence
MKTLLLTLVVVTIVCLDLGYT
   Click to Show/Hide
Sequence Removed Signal Peptide
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC
STDKCNPHPKQRPG
   Click to Show/Hide
Disulfide Bond
24-44;37-65;50-54;69-80;81-86
PDB ID
1ABT , 1BXP , 1HAA , 1HAJ , 1HC9 , 1HOY , 1IDG , 1IDH , 1IDI , 1IDL , 1IK8 , 1IKC , 1JBD , 1KC4 , 1KFH , 1KL8 , 1L4W , 1LJZ , 1RGJ , 2ABX , 2BTX , 6UWZ , 8DA1
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Lepidosauria
Order: Squamata
Family: Elapidae
Genus: Bungarus
Species: Bungarus multicinctus
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    nAChR Dissociation constant
0.4 nM
. . [1- 23]
 Target Info    nAChR chimeric alpha-7 Dissociation constant
0.95 nM
. . [1- 23]
 Target Info    GABA(A) receptor beta-3 Dissociation constant
50 nM
. . [1- 23]
 Target Info    GABA(A) receptor alpha-2-beta-2-gamma-2 Inhibition rate
62.3 %
20 μM
. [1- 23]
References
Ref 1 Genetic characterization of the mRNAs encoding alpha-bungarotoxin: isoforms and RNA editing in Bungarus multicinctus gland cells. Nucleic Acids Res. 1998 Dec 15;26(24):5624-9. doi: 10.1093/nar/26.24.5624.
Ref 2 Genetic organization of alpha-bungarotoxins from Bungarus multicinctus (Taiwan banded krait): evidence showing that the production of alpha-bungarotoxin isotoxins is not derived from edited mRNAs. Nucleic Acids Res. 1999 Oct 15;27(20):3970-5. doi: 10.1093/nar/27.20.3970.
Ref 3 Purification, properties and amino acid sequence of -bungarotoxin from the venom of Bungarus multicinctus. Hoppe Seylers Z Physiol Chem. 1972 Feb;353(2):243-62. doi: 10.1515/bchm2.1972.353.1.243.
Ref 4 Primary structure of alpha-bungarotoxin. Six amino acid residues differ from the previously reported sequence. FEBS Lett. 1987 Sep 28;222(1):79-82. doi: 10.1016/0014-5793(87)80195-3.
Ref 5 Isolation of antigenically reactive peptide fragments and localization of antigenic regions of alpha-bungarotoxin. Biochem Biophys Res Commun. 1988 Sep 15;155(2):870-6. doi: 10.1016/s0006-291x(88)80576-x.
Ref 6 cDNA sequence analysis and expression of alpha-bungarotoxin from Taiwan banded krait (Bungarus multicinctus). Biochem Biophys Res Commun. 1995 Nov 22;216(3):1088-94. doi: 10.1006/bbrc.1995.2732.
Ref 7 Structural studies of alpha-bungarotoxin. 3. Corrections in the primary sequence and X-ray structure and characterization of an isotoxic alpha-bungarotoxin. Biochemistry. 1988 Apr 19;27(8):2775-81. doi: 10.1021/bi00408a018.
Ref 8 Neutralizing monoclonal antibody specific for alpha-bungarotoxin: preparation and characterization of the antibody, and localization of antigenic region of alpha-bungarotoxin. FEBS Lett. 1989 Aug 28;254(1-2):106-10. doi: 10.1016/0014-5793(89)81018-x.
Ref 9 Only snake curaremimetic toxins with a fifth disulfide bond have high affinity for the neuronal alpha7 nicotinic receptor. J Biol Chem. 1997 Sep 26;272(39):24279-86. doi: 10.1074/jbc.272.39.24279.
Ref 10 Effects of alpha-erabutoxin, alpha-bungarotoxin, alpha-cobratoxin and fasciculin on the nicotine-evoked release of dopamine in the rat striatum in vivo. Neurochem Int. 1998 Oct;33(4):307-12. doi: 10.1016/s0197-0186(98)00033-3.
Ref 11 The cholinergic antagonist alpha-bungarotoxin also binds and blocks a subset of GABA receptors. Proc Natl Acad Sci U S A. 2006 Mar 28;103(13):5149-54. doi: 10.1073/pnas.0600847103. Epub 2006 Mar 20.
Ref 12 Neurotoxins from snake venoms and -conotoxin ImI inhibit functionally active ionotropic -aminobutyric acid (GABA) receptors. J Biol Chem. 2015 Sep 11;290(37):22747-58. doi: 10.1074/jbc.M115.648824. Epub 2015 Jul 28.
Ref 13 Snake neurotoxin -bungarotoxin is an antagonist at native GABA(A) receptors. Neuropharmacology. 2015 Jun;93:28-40. doi: 10.1016/j.neuropharm.2015.01.001. Epub 2015 Jan 26.
Ref 14 The crystal structure of alpha-bungarotoxin at 2.5 A resolution: relation to solution structure and binding to acetylcholine receptor. Protein Eng. 1986 Oct-Nov;1(1):37-46. doi: 10.1093/protein/1.1.37.
Ref 15 Structural studies of alpha-bungarotoxin. 1. Sequence-specific 1H NMR resonance assignments. Biochemistry. 1988 Apr 19;27(8):2763-71. doi: 10.1021/bi00408a016.
Ref 16 Structural studies of alpha-bungarotoxin. 2. 1H NMR assignments via an improved relayed coherence transfer nuclear overhauser enhancement experiment. Biochemistry. 1988 Apr 19;27(8):2772-5. doi: 10.1021/bi00408a017.
Ref 17 NMR solution structure of an alpha-bungarotoxin/nicotinic receptor peptide complex. Biochemistry. 1993 Nov 23;32(46):12290-8. doi: 10.1021/bi00097a004.
Ref 18 Three-dimensional solution structure of the complex of alpha-bungarotoxin with a library-derived peptide. Proc Natl Acad Sci U S A. 1997 Jun 10;94(12):6059-64. doi: 10.1073/pnas.94.12.6059.
Ref 19 The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica. J Biol Chem. 2001 Jun 22;276(25):22930-40. doi: 10.1074/jbc.M102300200. Epub 2001 Apr 18.
Ref 20 A beta -hairpin structure in a 13-mer peptide that binds alpha -bungarotoxin with high affinity and neutralizes its toxicity. Proc Natl Acad Sci U S A. 2001 Jun 5;98(12):6629-34. doi: 10.1073/pnas.111164298. Epub 2001 May 29.
Ref 21 NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor. Biochemistry. 2002 Feb 5;41(5):1457-63. doi: 10.1021/bi011012f.
Ref 22 NMR structural analysis of alpha-bungarotoxin and its complex with the principal alpha-neurotoxin-binding sequence on the alpha 7 subunit of a neuronal nicotinic acetylcholine receptor. J Biol Chem. 2002 Apr 5;277(14):12406-17. doi: 10.1074/jbc.M110320200. Epub 2002 Jan 14.
Ref 23 The mechanism for acetylcholine receptor inhibition by alpha-neurotoxins and species-specific resistance to alpha-bungarotoxin revealed by NMR. Neuron. 2002 Jul 18;35(2):319-32. doi: 10.1016/s0896-6273(02)00773-0.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.