Target Information

General Information of This Target
Target ID
BTDT00169
Target Name
Soluble acetylcholine receptor
Target Bioclass
Receptor
Uniprot ID
Q8WSF8
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene ID
100533247
Sequence
MLVSVYLALLVACVGQAHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKA
DSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLS
PQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQV
DLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRERRAGNGFFRNLFD

    Click to Show/Hide
Taxonomy ID
6500
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Mollusca
Class: Gastropoda
Order: Aplysiida
Family: Aplysiidae
Genus: Aplysia
Species: Aplysia californica
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Acidic phospholipase A2 CM-II IC50
>100 μM
 [1], [2], [3], [4]
 Toxin Info    Toxin BMLCL IC50
3.4 μM
 [5], [6], [7]
 Toxin Info    Azemiopsin IC50
230 μM
 [8]
References
Ref 1 Regional and accelerated molecular evolution in group I snake venom gland phospholipase A2 isozymes. Toxicon. 2000 Mar;38(3):449-62. doi: 10.1016/s0041-0101(99)00165-8.
Ref 2 Purification, some properties and amino-acid sequences of two phospholipases A (CM-II and CM-III) from Naja naja kaouthia venom. Eur J Biochem. 1980 Dec;112(3):493-9. doi: 10.1111/j.1432-1033.1980.tb06112.x.
Ref 3 A new type of thrombin inhibitor, noncytotoxic phospholipase A2, from the Naja haje cobra venom. Toxicon. 2010 Feb-Mar;55(2-3):186-94. doi: 10.1016/j.toxicon.2009.07.011. Epub 2009 Jul 19.
Ref 4 Inhibition of nicotinic acetylcholine receptors, a novel facet in the pleiotropic activities of snake venom phospholipases A2. PLoS One. 2014 Dec 18;9(12):e115428. doi: 10.1371/journal.pone.0115428. eCollection 2014.
Ref 5 cDNA sequence analysis of a novel member of the three loop protein family from the Chinese continental banded krait. Biosci Biotechnol Biochem. 1999 May;63(5):940-2. doi: 10.1271/bbb.63.940.
Ref 6 Muscarinic toxin-like proteins from Taiwan banded krait (Bungarus multicinctus) venom: purification, characterization and gene organization. Biol Chem. 2002 Sep;383(9):1397-406. doi: 10.1515/BC.2002.158.
Ref 7 Nonconventional three-finger toxin BMLCL from krait Bungarus multicinctus venom with high affinity interacts with nicotinic acetylcholine receptors. Dokl Biochem Biophys. 2015;464:294-7. doi: 10.1134/S1607672915050099. Epub 2015 Oct 31.
Ref 8 Azemiopsin from Azemiops feae viper venom, a novel polypeptide ligand of nicotinic acetylcholine receptor. J Biol Chem. 2012 Aug 3;287(32):27079-86. doi: 10.1074/jbc.M112.363051. Epub 2012 May 21.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.