Target Information
General Information of This Target
| Target ID |
BTDT00093
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
ATP-sensitive inward rectifier potassium channel 1 (KCNJ1)
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
KCNJ1
|
|||||
| Gene ID | ||||||
| Synonym |
ROMK1; ATP-regulated potassium channel ROM-K; Inward rectifier K(+) channel Kir1.1; Potassium channel, inwardly rectifying subfamily J member 1
|
|||||
| Sequence |
MNASSRNVFDTLIRVLTESMFKHLRKWVVTRFFGHSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSANHTP CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVIINSFMCGAILA KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGT VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY NEKDVRARMKRGYDNPNFILSEVNETDDTKM Click to Show/Hide
|
|||||
| Family |
the inward rectifier-type potassium channel family
|
|||||
| Function |
In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| TCDB ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info SsTx-4 (Y16A) | IC50 |
30.4 nM
|
[1] |
| Toxin Info SsTx-4 (R12A) | IC50 |
39.1 nM
|
[1] |
| Toxin Info SsTx-4 (Y49A) | IC50 |
60 nM
|
[1] |
| Toxin Info Mu-SLPTX (15)-Ssm1a (K5R,T7I,Y97) | IC50 |
89.2 nM
|
[1] |
| Toxin Info SsTx-4 (F43A) | IC50 |
89.2 nM
|
[1] |
| Toxin Info SsTx-4 (P41A) | IC50 |
89.2 nM
|
[1] |
| Toxin Info SsTx-4 (P8A) | IC50 |
89.2 nM
|
[1] |
| Toxin Info SsTx-4 (P15A) | IC50 |
159.7 nM
|
[1] |
| Toxin Info SsTx-4 (K10A) | IC50 |
178.4 nM
|
[1] |
| Toxin Info SsTx-4 (K40A) | IC50 |
178.4 nM
|
[1] |
| Toxin Info SsTx-4 (K45A) | IC50 |
178.4 nM
|
[1] |
| Toxin Info SsTx-4 (K4A) | IC50 |
178.4 nM
|
[1] |
| Toxin Info SsTx-4 (K17A) | IC50 |
178.4 nM
|
[1] |
| Toxin Info SsTx-4 (K40A,K45A) | IC50 |
356.8 nM
|
[1] |
| Toxin Info SsTx-4 (F9A) | IC50 |
446 nM
|
[1] |
| Toxin Info SsTx-4 (K4A,K45A) | IC50 |
446 nM
|
[1] |
| Toxin Info SsTx-4 (K4A,K40A) | IC50 |
535.2 nM
|
[1] |
| Toxin Info SsTx-4 (K11A) | IC50 |
561.2 nM
|
[1] |
| Toxin Info SsTx-4 (F43A,F44A) | IC50 |
713.6 nM
|
[1] |
| Toxin Info SsTx-4 (F44A) | IC50 |
981.2 nM
|
[1] |
| Toxin Info SsTx-4 (K4A,K40A,K45A) | IC50 |
981.2 nM
|
[1] |
| Toxin Info SsTx-4 (F14A) | IC50 |
1.2488 μM
|
[1] |
| Toxin Info SsTx-4 (K13A) | IC50 |
5.6196 μM
|
[1] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
