General Information of This Target
Target ID
BTDT00091
Target Name
Angiotensin-converting enzyme (Ace)
Target Bioclass
Enzyme
Uniprot ID
P47820
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
Ace
Gene ID
24310
Synonym
Dcp1; Dipeptidyl carboxypeptidase I; Kininase II; CD_antigen=CD143
Sequence
MGAASGQRGRWPLSPPLLMLSLLLLLLLPPSPAPALDPGLQPGNFSADEAGAQLFADSYN
SSAEVVMFQSTAASWAHDTNITEENARLQEEAALINQEFAEVWGKKAKELYESIWQNFTD
QKLRRIIGSVQTLGPANLPLTQRLQYNSLLSNMSRIYSTGKVCFPNKTATCWSLDPELTN
ILASSRNYAKVLFAWEGWHDAVGIPLRPLYQDFTALSNEAYRQDGFSDTGAYWRSWYESP
SFEESLEHLYHQVEPLYLNLHAFVRRALHRRYGDKYINLRGPIPAHLLGDMWAQSWENIY
DMVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLSPMPPEFWAESMLEKPADG
REVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDLHVSLRRGANP
GFHEAIGDVLALSVSTPAHLHKIGLLDRVANDIESDINYLLKMALEKIAFLPFGYLVDQW
RWGVFSGRTPPSRYNYDWWYLRTKYQGICPPVARNETHFDAGAKFHIPSVTPYIRYFVSF
VLQFQFHQALCKEAGHQGPLHQCDIYQSTKAGAKLQQVLQAGCSRPWQEVLKDLVGSDAL
DASALMEYFQPVSQWLQEQNQRNGEVLGWPEYQWRPPLPDNYPEGIDLETDEAKANRFVE
EYDRTAKVLWNEYAEANWHYNTNITIEGSKILLQKNKEVSNHTLKYGTWAKTFDVSNFQN
STIKRIIKKVQNVDRAVLPPNELEEYNQILLDMETTYSVANVCYTNGTCLSLEPDLTNIM
ATSRKYEELLWVWKSWRDKVGRAILPFFPKYVDFSNKIAKLNGYSDAGDSWRSSYESDDL
EQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDL
VAPFPSAPSIDATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGRE
VVCHASAWDFYNGKDFRIKQCTSVNMEELVIAHHEMGHIQYFMQYKDLPVTFREGANPGF
HEAIGDVLALSVSTPKHLHSLNLLSSEGSGYEHDINFLMKMALDKIAFIPFSYLIDQWRW
RVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYIRYFISFII
QFQFHEALCRAAGHTGPLYKCDIYQSKEAGKLLADAMKLGYSKQWPEAMKIITGQPNMSA
SAIMNYFKPLTEWLVTENRRHGETLGWPEYTWTPNTARAEGSLPESSRVNFLGMYLEPQQ
ARVGQWVLLFLGVALLVATVGLAHRLYNIHNHHSLRRPHRGPQFGSEVELRHS

    Click to Show/Hide
Family
the peptidase M2 family
Function
Dipeptidyl carboxypeptidase that removes dipeptides from the C-terminus of a variety of circulating hormones, such as angiotensin I, bradykinin or enkephalins, thereby playing a key role in the regulation of blood pressure, electrolyte homeostasis or synaptic plasticity. Composed of two similar catalytic domains, each possessing a functional active site, with different selectivity for substrates. Plays a major role in the angiotensin-renin system that regulates blood pressure and sodium retention by the kidney by converting angiotensin I to angiotensin II, resulting in an increase of the vasoconstrictor activity of angiotensin. Also able to inactivate bradykinin, a potent vasodilator, and therefore enhance the blood pressure response. Acts as a regulator of synaptic transmission by mediating cleavage of neuropeptide hormones, such as substance P, neurotensin or enkephalins. Catalyzes degradation of different enkephalin neuropeptides (Met- enkephalin, Leu-enkephalin, Met-enkephalin-Arg-Phe and possibly Met- enkephalin-Arg-Gly-Leu). Acts as a regulator of synaptic plasticity in the nucleus accumbens of the brain by mediating cleavage of Met-enkephalin-Arg-Phe, a strong ligand of Mu-type opioid receptor OPRM1, into Met-enkephalin. Met-enkephalin- Arg-Phe cleavage by ACE decreases activation of OPRM1, leading to long- term synaptic potentiation of glutamate release. Also acts as a regulator of hematopoietic stem cell differentiation by mediating degradation of hemoregulatory peptide N-acetyl-SDKP (AcSDKP). Acts as a regulator of cannabinoid signaling pathway by mediating degradation of hemopressin, an antagonist peptide of the cannabinoid receptor CNR1. Involved in amyloid-beta metabolism by catalyzing degradation of Amyloid-beta protein 40 and Amyloid-beta protein 42 peptides, thereby preventing plaque formation. Catalyzes cleavage of cholecystokinin (maturation of Cholecystokinin-8 and Cholecystokinin-5) and Gonadoliberin-1 (both maturation and degradation) hormones. Degradation of hemoregulatory peptide N-acetyl-SDKP (AcSDKP) and amyloid-beta proteins is mediated by the N-terminal catalytic domain, while angiotensin I and cholecystokinin cleavage is mediated by the C-terminal catalytic region. [Angiotensin-converting enzyme, soluble form]: Soluble form that is released in blood plasma and other body fluids following proteolytic cleavage in the juxtamembrane stalk region. [Isoform Testis-specific]: Isoform produced by alternative promoter usage that is specifically expressed in spermatocytes and adult testis, and which is required for male fertility. In contrast to somatic isoforms, only contains one catalytic domain. Acts as a dipeptidyl carboxypeptidase that removes dipeptides from the C-terminus of substrates. The identity of substrates that are needed for male fertility is unknown. May also have a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. The GPIase activity was reported to be essential for the egg-binding ability of the sperm. This activity is however unclear and has been challenged by other groups, suggesting that it may be indirect.

    Click to Show/Hide
Taxonomy ID
10116
EC Number
3.4.15.1
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Rodentia
Family: Muridae
Genus: Rattus
Species: Rattus norvegicus
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    Bradykinin-potentiating peptide 10 g-AP Inhibition constant
1 mM
[1]
 Toxin Info    Megascoliakinin Inhibition constant
1.6 μM
[2], [3]
 Toxin Info    [Thr6]-bradykinin Inhibition constant
1.6 μM
[4]
 Toxin Info    Kininogen-2 Inhibition constant
1.6 μM
[5], [6]
 Toxin Info    Cyphokinin Inhibition constant
1.6 μM
[3- 8]
 Toxin Info    [Thr6]-bradykinin Inhibition constant
1.6 μM
[9]
 Toxin Info    [Thr6]-bradykinin RA-11 Inhibition constant
1.6 μM
[10], [11]
 Toxin Info    Phyllokinin-1 Inhibition constant
1.6 μM
[12]
 Toxin Info    Kininogen-1 Inhibition constant
1.6 μM
[13]
References
Ref 1 Isolation and biochemical characterization of bradykinin-potentiating peptides from Bitis gabonica rhinoceros. J Venom Anim Toxins Incl Trop Dis. 2017 Jun 26;23:33. doi: 10.1186/s40409-017-0124-9. eCollection 2017.
Ref 2 Two kinins isolated from an extract of the venom reservoirs of the solitary wasp Megascolia flavifrons. Toxicon. 1987;25(5):527-35. doi: 10.1016/0041-0101(87)90288-1.
Ref 3 Peptide Toxins in Solitary Wasp Venoms. Toxins (Basel). 2016 Apr 18;8(4):114. doi: 10.3390/toxins8040114.
Ref 4 Novel bradykinins and their precursor cDNAs from European yellow-bellied toad (Bombina variegata) skin. Eur J Biochem. 2002 Sep;269(18):4693-700. doi: 10.1046/j.1432-1033.2002.03174.x.
Ref 5 Bradykinins and their precursor cDNAs from the skin of the fire-bellied toad (Bombina orientalis). Peptides. 2002 Sep;23(9):1547-55. doi: 10.1016/s0196-9781(02)00095-5.
Ref 6 Peptide DV-28 amide: An inhibitor of bradykinin-induced arterial smooth muscle relaxation encoded by Bombina orientalis skin kininogen-2. Peptides. 2010 May;31(5):979-82. doi: 10.1016/j.peptides.2010.01.016. Epub 2010 Feb 6.
Ref 7 Bradykinin-related peptides in the venom of the solitary wasp Cyphononyx fulvognathus. Biochem Pharmacol. 2010 Feb 1;79(3):478-86. doi: 10.1016/j.bcp.2009.08.020. Epub 2009 Aug 27.
Ref 8 Isolation and sequence determination of peptides in the venom of the spider wasp (Cyphononyx dorsalis) guided by matrix-assisted laser desorption/ionization time of flight (MALDI-TOF) mass spectrometry. Toxicon. 2001 Aug;39(8):1257-60. doi: 10.1016/s0041-0101(00)00262-2.
Ref 9 Bradykinin-related peptides from Phyllomedusa hypochondrialis. Peptides. 2006 Sep;27(9):2137-46. doi: 10.1016/j.peptides.2006.04.020. Epub 2006 Jun 22.
Ref 10 De novo sequencing of peptides secreted by the skin glands of the Caucasian Green Frog Rana ridibunda. Rapid Commun Mass Spectrom. 2008 Nov;22(22):3517-25. doi: 10.1002/rcm.3759.
Ref 11 Differentiation of frogs from two populations belonging to the Pelophylax esculentus complex by LC-MS/MS comparison of their skin peptidomes. Anal Bioanal Chem. 2017 Mar;409(7):1951-1961. doi: 10.1007/s00216-016-0143-3. Epub 2016 Dec 23.
Ref 12 Bradykinin-related peptides from Phyllomedusa hypochondrialis azurea: Mass spectrometric structural characterisation and cloning of precursor cDNAs. Rapid Commun Mass Spectrom. 2006;20(24):3780-8. doi: 10.1002/rcm.2791.
Ref 13 Cloning of the (Thr6)-phyllokinin precursor from Phyllomedusa sauvagei skin confirms a non-consensus tyrosine O-sulfation motif. Peptides. 2003 Aug;24(8):1123-30. doi: 10.1016/j.peptides.2003.06.002.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.