General Information of This Target
Target ID
BTDT00085
Target Name
TGF-beta receptor type-1 (TGFBR1)
Target Bioclass
Enzyme
Uniprot ID
P36897
3D Structure
Download
2D Sequence
3D Structure
Source
Predict by Alphafold2
?
Alphafold Parameters: msa_mode: mmseqs2_uniref_env model_type: auto num_recycles: auto
Gene Name
TGFBR1
Gene ID
7046
Synonym
ALK5; SKR4; Activin A receptor type II-like protein kinase of 53kD; Activin receptor-like kinase 5; Serine/threonine-protein kinase receptor R4; TGF-beta type I receptor; Transforming growth factor-beta receptor type I
Sequence
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM

    Click to Show/Hide
Family
the protein kinase superfamily. TKL Ser/Thr protein kinase family
Function
Transmembrane serine/threonine kinase forming with the TGF- beta type II serine/threonine kinase receptor, TGFBR2, the non- promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, TGFBR1 induces TRAF6 autoubiquitination which in turn results in MAP3K7 ubiquitination and activation to trigger apoptosis. Also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway through PARD6A phosphorylation and activation.

    Click to Show/Hide
Taxonomy ID
9606
EC Number
2.7.11.30
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Toxin Information Related to This Target
                           Toxin Name Activity Data Type Activity Data Reference
 Toxin Info    SsTx-4 (Y49A) IC50
120 nM
[1]
 Toxin Info    SsTx-4 (R12A) IC50
122.6 nM
[1]
 Toxin Info    Ssm spooky toxin (K40A,K45A) IC50
360 nM
[1]
 Toxin Info    Ssm spooky toxin (P8A) IC50
360 nM
[1]
 Toxin Info    SsTx-4 (P41A) IC50
360 nM
[1]
 Toxin Info    SsTx-4 (K10A) IC50
360 nM
[1]
 Toxin Info    SsTx-4 (K40A) IC50
360 nM
[1]
 Toxin Info    SsTx-4 (K45A) IC50
360 nM
[1]
 Toxin Info    Mu-SLPTX (15)-Ssm1a (K5R,T7I,Y97) IC50
360.1 nM
[1]
 Toxin Info    SsTx-4 (Y16A) IC50
420.5 nM
[1]
 Toxin Info    SsTx-4 (K40A,K45A) IC50
720 nM
[1]
 Toxin Info    SsTx-4 (K4A,K45A) IC50
720 nM
[1]
 Toxin Info    SsTx-4 (K4A) IC50
720 nM
[1]
 Toxin Info    SsTx-4 (K11A) IC50
1.065 μM
[1]
 Toxin Info    Ssm spooky toxin (K4A,K40A,K45A) IC50
1.08 μM
[1]
 Toxin Info    SsTx-4 (K4A,K40A) IC50
1.08 μM
[1]
 Toxin Info    SsTx-4 (F9A) IC50
1.44 μM
[1]
 Toxin Info    SsTx-4 (F14A) IC50
1.8 μM
[1]
 Toxin Info    SsTx-4 (P15A) IC50
2.158 μM
[1]
 Toxin Info    SsTx-4 (F43A) IC50
19.44 μM
[1]
 Toxin Info    SsTx-4 (K13A) IC50
22.32 μM
[1]
 Toxin Info    SsTx-4 (F44A) IC50
33.84 μM
[1]
 Toxin Info    SsTx-4 (F43A,F44A) IC50
61.2 μM
[1]
References
Ref 1 Molecular mechanisms of centipede toxin SsTx-4 inhibition of inwardly rectifying potassium channels. J Biol Chem. 2021 Sep;297(3):101076. doi: 10.1016/j.jbc.2021.101076. Epub 2021 Aug 12.
Ref 2 A novel high-affinity inhibitor against the human ATP-sensitive Kir6.2 channel. J Gen Physiol. 2018 Jul 2;150(7):969-976. doi: 10.1085/jgp.201812017. Epub 2018 May 29.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.