Target Information
General Information of This Target
| Target ID |
BTDT00085
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
TGF-beta receptor type-1 (TGFBR1)
|
|||||
| Target Bioclass |
Enzyme
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Gene Name |
TGFBR1
|
|||||
| Gene ID | ||||||
| Synonym |
ALK5; SKR4; Activin A receptor type II-like protein kinase of 53kD; Activin receptor-like kinase 5; Serine/threonine-protein kinase receptor R4; TGF-beta type I receptor; Transforming growth factor-beta receptor type I
|
|||||
| Sequence |
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA ARLTALRIKKTLSQLSQQEGIKM Click to Show/Hide
|
|||||
| Family |
the protein kinase superfamily. TKL Ser/Thr protein kinase family
|
|||||
| Function |
Transmembrane serine/threonine kinase forming with the TGF- beta type II serine/threonine kinase receptor, TGFBR2, the non- promiscuous receptor for the TGF-beta cytokines TGFB1, TGFB2 and TGFB3. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and is thus regulating a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and the activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways. For instance, TGFBR1 induces TRAF6 autoubiquitination which in turn results in MAP3K7 ubiquitination and activation to trigger apoptosis. Also regulates epithelial to mesenchymal transition through a SMAD-independent signaling pathway through PARD6A phosphorylation and activation.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| EC Number | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info SsTx-4 (Y49A) | IC50 |
120 nM
|
[1] |
| Toxin Info SsTx-4 (R12A) | IC50 |
122.6 nM
|
[1] |
| Toxin Info Ssm spooky toxin (K40A,K45A) | IC50 |
360 nM
|
[1] |
| Toxin Info Ssm spooky toxin (P8A) | IC50 |
360 nM
|
[1] |
| Toxin Info SsTx-4 (P41A) | IC50 |
360 nM
|
[1] |
| Toxin Info SsTx-4 (K10A) | IC50 |
360 nM
|
[1] |
| Toxin Info SsTx-4 (K40A) | IC50 |
360 nM
|
[1] |
| Toxin Info SsTx-4 (K45A) | IC50 |
360 nM
|
[1] |
| Toxin Info Mu-SLPTX (15)-Ssm1a (K5R,T7I,Y97) | IC50 |
360.1 nM
|
[1] |
| Toxin Info SsTx-4 (Y16A) | IC50 |
420.5 nM
|
[1] |
| Toxin Info SsTx-4 (K40A,K45A) | IC50 |
720 nM
|
[1] |
| Toxin Info SsTx-4 (K4A,K45A) | IC50 |
720 nM
|
[1] |
| Toxin Info SsTx-4 (K4A) | IC50 |
720 nM
|
[1] |
| Toxin Info SsTx-4 (K11A) | IC50 |
1.065 μM
|
[1] |
| Toxin Info Ssm spooky toxin (K4A,K40A,K45A) | IC50 |
1.08 μM
|
[1] |
| Toxin Info SsTx-4 (K4A,K40A) | IC50 |
1.08 μM
|
[1] |
| Toxin Info SsTx-4 (F9A) | IC50 |
1.44 μM
|
[1] |
| Toxin Info SsTx-4 (F14A) | IC50 |
1.8 μM
|
[1] |
| Toxin Info SsTx-4 (P15A) | IC50 |
2.158 μM
|
[1] |
| Toxin Info SsTx-4 (F43A) | IC50 |
19.44 μM
|
[1] |
| Toxin Info SsTx-4 (K13A) | IC50 |
22.32 μM
|
[1] |
| Toxin Info SsTx-4 (F44A) | IC50 |
33.84 μM
|
[1] |
| Toxin Info SsTx-4 (F43A,F44A) | IC50 |
61.2 μM
|
[1] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
