Peptide Information

General Information of This Peptide
Peptide ID
BTDP008720
Peptide Name
Potassium channel toxin gamma-KTx 1.1
Symonym
Ergtoxin
Species
Centruroides noxius (Mexican scorpion)
Uniprot Name
KGX11_CENNO
Alphafold ID
Q86QT3
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1NE5
Sequence
MKVLILIMIIASLMIMGVEMDRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCK
CA
   Click to Show/Hide
Sequence Length
62
Mass (Da)
6970
Sequence Removed Signal Peptide
DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
   Click to Show/Hide
Disulfide Bond
25-43;31-54;40-59;44-61
PDB ID
1NE5 , 1PX9
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Arthropoda
Class: Arachnida
Order: Scorpiones
Family: Buthidae
Genus: Centruroides
Species: Centruroides noxius
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Kv11.2 Dissociation constant
2.8 nM
 .
Irreversible
 [1- 12]
 Target Info    Kv11.2 Dissociation constant
2.8 nM
 .
Blocker
 [1- 27]
 Target Info    Kv11.3 Dissociation constant
4.05 nM
 .
Irreversible
 [1- 12]
 Target Info    Kv11.3 Dissociation constant
4.05 nM
 .
Blocker
 [7]
 Target Info    Kv11 Dissociation constant
4.5 nM
 .
Blocker
 [7]
 Target Info    Kv11.1 Dissociation constant
6.8 nM
 .
Reversible
 [1- 12]
 Target Info    Kv11.1 Dissociation constant
6.8 nM
 .
Blocker
 [1- 27]
 Target Info    Kv11.3 Dissociation constant
38.1 nM
 .
Reversible
 [1- 12]
 Target Info    Kv11.3 Dissociation constant
38.1 nM
 .
Blocker
 [1- 27]
 Target Info    Kv1.4 Inhibition rate .
50 nM
Reversible
 [1- 12]
 Target Info    ELK1 Inhibition rate .
200 nM
Reversible
 [1- 12]
 Target Info    EAG1 Inhibition rate .
200 nM
Reversible
 [1- 12]
 Target Info    Kv11.2 Inhibition rate .
210 nM
Blocker
 [7]
 Target Info    Kv2.1 Inhibition rate .
50 nM
Reversible
 [1- 12]
 Target Info    Kv4.3 Inhibition rate .
50 nM
Reversible
 [1- 12]
 Target Info    Kv7.1 Inhibition rate .
50 nM
Reversible
 [1- 12]
 Target Info    Kv11.1 Inhibition rate
93.5 %
 .
Block macroscopic current
 [1- 12]
 Target Info    Kv11/ERG IC50
˜7 nM
 .
Reversible
 [1- 12]
References
Ref 1 A large number of novel Ergtoxin-like genes and ERG K+-channels blocking peptides from scorpions of the genus Centruroides. FEBS Lett. 2002 Dec 4;532(1-2):121-6. doi: 10.1016/s0014-5793(02)03652-9.
Ref 2 A toxin to nervous, cardiac, and endocrine ERG K+ channels isolated from Centruroides noxius scorpion venom. FASEB J. 1999 May;13(8):953-62.
Ref 3 Disulfide bridges of ergtoxin, a member of a new sub-family of peptide blockers of the ether-a-go-go-related K+ channel. FEBS Lett. 2000 Aug 18;479(3):156-7. doi: 10.1016/s0014-5793(00)01891-3.
Ref 4 Mapping the receptor site for ergtoxin, a specific blocker of ERG channels. FEBS Lett. 2002 Jan 2;510(1-2):45-9. doi: 10.1016/s0014-5793(01)03218-5.
Ref 5 Mapping the binding site of a human ether-a-go-go-related gene-specific peptide toxin (ErgTx) to the channel's outer vestibule. J Biol Chem. 2002 May 10;277(19):16403-11. doi: 10.1074/jbc.M200460200. Epub 2002 Feb 25.
Ref 6 Preferential closed channel blockade of HERG potassium currents by chemically synthesised BeKm-1 scorpion toxin. FEBS Lett. 2003 Jul 17;547(1-3):20-6. doi: 10.1016/s0014-5793(03)00662-8.
Ref 7 Species diversity and peptide toxins blocking selectivity of ether-a-go-go-related gene subfamily K+ channels in the central nervous system. Mol Pharmacol. 2006 May;69(5):1673-83. doi: 10.1124/mol.105.019729. Epub 2006 Feb 23.
Ref 8 Mechanism of block of the hERG K+ channel by the scorpion toxin CnErg1. Biophys J. 2007 Jun 1;92(11):3915-29. doi: 10.1529/biophysj.106.101956. Epub 2007 Mar 16.
Ref 9 Recombinant expression of the toxic peptide ErgTx1 and role of Met35 on its stability and function. Peptides. 2011 Mar;32(3):560-7. doi: 10.1016/j.peptides.2010.06.018. Epub 2010 Jun 30.
Ref 10 Positive selection-guided mutational analysis revealing two key functional sites of scorpion ERG K(+) channel toxins. Biochem Biophys Res Commun. 2012 Dec 7;429(1-2):111-6. doi: 10.1016/j.bbrc.2012.10.065. Epub 2012 Oct 24.
Ref 11 Solution structure of CnErg1 (Ergtoxin), a HERG specific scorpion toxin. FEBS Lett. 2003 Mar 27;539(1-3):138-42. doi: 10.1016/s0014-5793(03)00216-3.
Ref 12 Exploring structural features of the interaction between the scorpion toxinCnErg1 and ERG K+ channels. Proteins. 2004 Aug 1;56(2):367-75. doi: 10.1002/prot.20102.
Ref 13 Erratum to "From goal to outcome: Analyzing the progression of biomedical sciences PhD careers in a longitudinal study using an expanded taxonomy". FASEB Bioadv. 2023 Dec 1;6(1):40. doi: 10.1096/fba.2023-00134. eCollection 2024 Jan.
Ref 14 Retraction: Methionine-CBS axis promotes intracellular ROS levels by reprogramming serine metabolism. FASEB J. 2024 Jan 31;38(2):e23412. doi: 10.1096/fsb2.23412.
Ref 15 Gross Anatomy Teaching for Medical Undergraduates Through Computer-Based Simulation: Introduction and Evaluation of Effectiveness. Cureus. 2023 Nov 27;15(11):e49517. doi: 10.7759/cureus.49517. eCollection 2023 Nov.
Ref 16 Erratum to "The roles of HMGB1-produced DNA gaps in DNA protection and aging biomarker reversal". FASEB Bioadv. 2023 Jan 25;5(2):85-87. doi: 10.1096/fba.1365. eCollection 2023 Feb.
Ref 17 Erratum. FASEB Bioadv. 2021 Jun 3;3(7):558. doi: 10.1096/fba.1251. eCollection 2021 Jul.
Ref 18 WITHDRAWN: Adipocyte Deletion of ADAM17 Leads to Insulin Resistance in Association with Age and HFD in Mice. FASEB J. 2021 May;35 Suppl 1. doi: 10.1096/fasebj.2021.35.S1.00447.
Ref 19 RETRACTED: circTulp4 functions in Alzheimers disease pathogenesis by regulating its parental gene, Tulp4. Mol Ther. 2021 Jun 2;29(6):2167-2181. doi: 10.1016/j.ymthe.2021.02.008. Epub 2021 Feb 10.
Ref 20 BCL-2 Inhibitor Venetoclax Induces Autophagy-Associated Cell Death, Cell Cycle Arrest, and Apoptosis in Human Breast Cancer Cells. Onco Targets Ther. 2020 Dec 31;13:13357-13370. doi: 10.2147/OTT.S281519. eCollection 2020.
Ref 21 Anatomical Study of the Innervation of the Masseter Muscle and Its Correlation with Myofascial Trigger Points. J Pain Res. 2020 Dec 2;13:3217-3226. doi: 10.2147/JPR.S265717. eCollection 2020.
Ref 22 Withdrawn: A Controllable Protein Translation Strategy for Exploring Cellular Signal Transduction Based on Reading through Premature Termination Codons. FASEB J. 2020 Apr;34(S1):1. doi: 10.1096/fasebj.2020.34.s1.09195.
Ref 23 Withdrawn: Invisible State of MdmX and Design of its Inhibitors. FASEB J. 2020 Apr;34(S1):1. doi: 10.1096/fasebj.2020.34.s1.09193.
Ref 24 Experimental Biology 2020 Meeting Abstracts. FASEB J. 2020 Apr;34(S1):1. doi: 10.1096/fasebj.2020.34.s1.07600.
Ref 25 A novel small animal model for HIV-1 infection. FASEB J. 2005 Jul;19(9):1149-51. doi: 10.1096/fj.04-3184fje. Epub 2005 Apr 15.
Ref 26 Enhanced HIV-1 specific immune response by CpG ODN and HIV-1 immunogen-pulsed dendritic cells confers protection in the Trimera murine model of HIV-1 infection. FASEB J. 2005 Jul;19(9):1152-4. doi: 10.1096/fj.04-3185fje. Epub 2005 Apr 15.
Ref 27 Abnormalities in intracellular Ca2+ regulation in fetal vascular smooth muscle in pre-eclampsia: enhanced sensitivity to arachidonic acid. FASEB J. 2003 Feb;17(2):307-9. doi: 10.1096/fj.02-0507fje. Epub 2002 Dec 17.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.