Peptide Information

General Information of This Peptide
Peptide ID
BTDP006693
Peptide Name
Alpha-conotoxin RegIIA
Symonym
Reg2a
Species
Conus regius (Crown cone)
Uniprot Name
CA12A_CONRE
Alphafold ID
P85013
3D Structure
Download
2D Sequence
3D Structure
Source
Alphafold db: P85013
Sequence
MGMRMMFTVFLLVVLTTTVVSSTSVRASDGRNAAADNRASDLIAQIVRRGCCSHPACNVN
NPHICG
   Click to Show/Hide
Sequence Length
66
Mass (Da)
7038
Signal Sequence
MGMRMMFTVFLLVVLTTTVVS
   Click to Show/Hide
Sequence Removed Signal Peptide
STSVRASDGRNAAADNRASDLIAQIVRRGCCSHPACNVNNPHICG
   Click to Show/Hide
Disulfide Bond
51-57;52-65
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Mollusca
Class: Gastropoda
Order: Neogastropoda
Family: Conidae
Genus: Conus
Species: Conus regius
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    nAChR alpha-3-beta-4 IC50
2.8 nM
 . . [1- 7]
 Target Info    nAChR alpha-3-beta-2 IC50
10.7 - 33 nM
 . . [1- 7]
 Target Info    nAChR alpha-7 IC50
41 - 61.2 nM
 . . [1- 7]
 Target Info    nAChR alpha-3-beta-4 IC50
47.3 - 97 nM
 . . [1- 7]
 Target Info    nAChR alpha-7 IC50
103 - 210 nM
 . . [1- 7]
 Target Info    nAChR alpha-3-beta-2 IC50
132.4 - 704.1 nM
 . . [1- 7]
References
Ref 1 RegIIA: an 4/7-conotoxin from the venom of Conus regius that potently blocks 34 nAChRs. Biochem Pharmacol. 2012 Feb 1;83(3):419-26. doi: 10.1016/j.bcp.2011.11.006. Epub 2011 Nov 16.
Ref 2 Hyperhydroxylation: a new strategy for neuronal targeting by venomous marine molluscs. Prog Mol Subcell Biol. 2006;43:83-103. doi: 10.1007/978-3-540-30880-5_4.
Ref 3 Alanine scan of -conotoxin RegIIA reveals a selective 34 nicotinic acetylcholine receptor antagonist. J Biol Chem. 2015 Jan 9;290(2):1039-48. doi: 10.1074/jbc.M114.605592. Epub 2014 Nov 19.
Ref 4 Molecular Basis for Differential Sensitivity of -Conotoxin RegIIA at Rat and Human Neuronal Nicotinic Acetylcholine Receptors. Mol Pharmacol. 2015 Dec;88(6):993-1001. doi: 10.1124/mol.115.100503. Epub 2015 Oct 5.
Ref 5 Key Structural Determinants in the Agonist Binding Loops of Human 2 and 4 Nicotinic Acetylcholine Receptor Subunits Contribute to 34 Subtype Selectivity of -Conotoxins. J Biol Chem. 2016 Nov 4;291(45):23779-23792. doi: 10.1074/jbc.M116.730804. Epub 2016 Sep 19.
Ref 6 Species specificity of rat and human 7 nicotinic acetylcholine receptors towards different classes of peptide and protein antagonists. Neuropharmacology. 2018 Sep 1;139:226-237. doi: 10.1016/j.neuropharm.2018.07.019. Epub 2018 Jul 17.
Ref 7 Rational Design of -Conotoxin RegIIA Analogues Selectively Inhibiting the Human 32 Nicotinic Acetylcholine Receptor through Computational Scanning. ACS Chem Neurosci. 2020 Sep 16;11(18):2804-2811. doi: 10.1021/acschemneuro.0c00293. Epub 2020 Sep 3.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.