Peptide Information

General Information of This Peptide
Peptide ID
BTDP003995
Peptide Name
Ziconotide
Symonym
SNX-111; INN=Ziconotide;Omega-conotoxin MVIIA;Ziconotide/SNX-111/MVIIA
Species
Conus magus (Magical cone)
Uniprot Name
O17A_CONMA
Alphafold ID
P05484
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1DW4
Sequence
MKLTCVVIVAVLLLTACQLITADDSRGTQKHRALRSTTKLSTSTRCKGKGAKCSRLMYDC
CTGSCRSGKCG
   Click to Show/Hide
Sequence Length
71
Mass (Da)
7587
Signal Sequence
MKLTCVVIVAVLLLTACQLITA
   Click to Show/Hide
Sequence Removed Signal Peptide
DDSRGTQKHRALRSTTKLSTSTRCKGKGAKCSRLMYDCCTGSCRSGKCG
   Click to Show/Hide
Disulfide Bond
46-61;53-65;60-70
PDB ID
1DW4 , 1DW5 , 1FEO , 1MVI , 1OMG , 1TT3 , 1TTK , 7MIX , 7VFU
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Mollusca
Class: Gastropoda
Order: Neogastropoda
Family: Conidae
Genus: Conus
Species: Conus magus
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Cav2.2 IC50
0.67 - 208 nM
 . . [1- 18]
References
Ref 1 Novel omega-conotoxins from Conus catus discriminate among neuronal calcium channel subtypes. J Biol Chem. 2000 Nov 10;275(45):35335-44. doi: 10.1074/jbc.M002252200.
Ref 2 Evolution of Conus peptide toxins: analysis of Conus californicus Reeve, 1844. Mol Phylogenet Evol. 2010 Jul;56(1):1-12. doi: 10.1016/j.ympev.2010.03.029. Epub 2010 Apr 2.
Ref 3 Peptide neurotoxins from fish-hunting cone snails. Science. 1985 Dec 20;230(4732):1338-43. doi: 10.1126/science.4071055.
Ref 4 Neuronal calcium channel antagonists. Discrimination between calcium channel subtypes using omega-conotoxin from Conus magus venom. Biochemistry. 1987 Apr 21;26(8):2086-90. doi: 10.1021/bi00382a004.
Ref 5 Determination of disulfide bridge pattern in omega-conopeptides. Int J Pept Protein Res. 1995 Sep-Oct;46(3-4):320-5. doi: 10.1111/j.1399-3011.1995.tb00604.x.
Ref 6 Tyr13 is essential for the activity of omega-conotoxin MVIIA and GVIA, specific N-type calcium channel blockers. Biochem Biophys Res Commun. 1995 Jan 17;206(2):449-54. doi: 10.1006/bbrc.1995.1063.
Ref 7 Ziconotide: neuronal calcium channel blocker for treating severe chronic pain. Curr Med Chem. 2004 Dec;11(23):3029-40. doi: 10.2174/0929867043363884.
Ref 8 Molecular basis of toxicity of N-type calcium channel inhibitor MVIIA. Neuropharmacology. 2016 Feb;101:137-45. doi: 10.1016/j.neuropharm.2015.08.047. Epub 2015 Sep 4.
Ref 9 Pre-clinical evaluation of voltage-gated calcium channel blockers derived from the spider P.?nigriventer in glioma progression. Toxicon. 2017 Apr;129:58-67. doi: 10.1016/j.toxicon.2017.02.001. Epub 2017 Feb 13.
Ref 10 Novel analgesic -conotoxins from the vermivorous cone snail Conus moncuri provide new insights into the evolution of conopeptides. Sci Rep. 2018 Sep 7;8(1):13397. doi: 10.1038/s41598-018-31245-4.
Ref 11 A novel -conotoxin Bu8 inhibiting N-type voltage-gated calcium channels displays potent analgesic activity. Acta Pharm Sin B. 2021 Sep;11(9):2685-2693. doi: 10.1016/j.apsb.2021.03.001. Epub 2021 Mar 18.
Ref 12 Three-dimensional structure in solution of the calcium channel blocker omega-conotoxin MVIIA. Biochemistry. 1995 Aug 15;34(32):10256-65. doi: 10.1021/bi00032a020.
Ref 13 Solution structure of omega-conotoxin MVIIA using 2D NMR spectroscopy. FEBS Lett. 1995 Aug 21;370(3):163-9. doi: 10.1016/0014-5793(95)00819-u.
Ref 14 A consensus structure for omega-conotoxins with different selectivities for voltage-sensitive calcium channel subtypes: comparison of MVIIA, SVIB and SNX-202. J Mol Biol. 1996 Oct 25;263(2):297-310. doi: 10.1006/jmbi.1996.0576.
Ref 15 Structure-activity relationships of omega-conotoxins MVIIA, MVIIC and 14 loop splice hybrids at N and P/Q-type calcium channels. J Mol Biol. 1999 Jun 25;289(5):1405-21. doi: 10.1006/jmbi.1999.2817.
Ref 16 Structural and dynamic characterization of omega-conotoxin MVIIA: the binding loop exhibits slow conformational exchange. Biochemistry. 2000 Apr 11;39(14):3908-19. doi: 10.1021/bi992651h.
Ref 17 Solution structure and backbone dynamics of an omega-conotoxin precursor. Protein Sci. 2001 Mar;10(3):538-50. doi: 10.1110/ps.30701.
Ref 18 Structure of human Ca(v)2.2 channel blocked by the painkiller ziconotide. Nature. 2021 Aug;596(7870):143-147. doi: 10.1038/s41586-021-03699-6. Epub 2021 Jul 7.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.