Peptide Information

General Information of This Peptide
Peptide ID
BTDP003966
Peptide Name
Omega-conotoxin GVIA
Symonym
SNX-124; Shaker peptide
Species
Conus geographus (Geography cone) (Nubecula geographus)
Uniprot Name
O16A_CONGE
Alphafold ID
P01522
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1OMC
Sequence
MKLTCVVIVAVLLLTACQLITADDSRGTQKHRALGSTTELSLSTRCKSPGSSCSPTSYNC
CRSCNPYTKRCYG
   Click to Show/Hide
Sequence Length
73
Mass (Da)
7851
Signal Sequence
MKLTCVVIVAVLLLTACQLITA
   Click to Show/Hide
Sequence Removed Signal Peptide
DDSRGTQKHRALGSTTELSLSTRCKSPGSSCSPTSYNCCRSCNPYTKRCYG
   Click to Show/Hide
Disulfide Bond
46-61;53-64;60-71
PDB ID
1OMC , 1TR6 , 1TTL , 2CCO
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Mollusca
Class: Gastropoda
Order: Neogastropoda
Family: Conidae
Genus: Conus
Species: Conus geographus
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    Cav2.2 IC50
3.7 - 38 pM
 .
Displace [125I]GVIA
 [1- 15]
 Target Info    Cav2.1 IC50
1.05 μM
 .
Displace [125I]MVIIC
 [1- 15]
References
Ref 1 Precursor structure of omega-conotoxin GVIA determined from a cDNA clone. Toxicon. 1992 Sep;30(9):1111-6. doi: 10.1016/0041-0101(92)90056-b.
Ref 2 Purification and sequence of a presynaptic peptide toxin from Conus geographus venom. Biochemistry. 1984 Oct 23;23(22):5087-90. doi: 10.1021/bi00317a001.
Ref 3 Peptide neurotoxins from fish-hunting cone snails. Science. 1985 Dec 20;230(4732):1338-43. doi: 10.1126/science.4071055.
Ref 4 Synthesis and secondary-structure determination of omega-conotoxin GVIA: a 27-peptide with three intramolecular disulfide bonds. Biopolymers. 1986;25 Suppl:S61-8.
Ref 5 Role of basic residues for the binding of omega-conotoxin GVIA to N-type calcium channels. Biochem Biophys Res Commun. 1993 Aug 16;194(3):1292-6. doi: 10.1006/bbrc.1993.1964.
Ref 6 Hydroxyl group of Tyr13 is essential for the activity of omega-conotoxin GVIA, a peptide toxin for N-type calcium channel. J Biol Chem. 1994 Sep 30;269(39):23876-8.
Ref 7 Structure-function relationships of omega-conotoxin GVIA. Synthesis, structure, calcium channel binding, and functional assay of alanine-substituted analogues. J Biol Chem. 1997 May 2;272(18):12014-23. doi: 10.1074/jbc.272.18.12014.
Ref 8 Novel omega-conotoxins from Conus catus discriminate among neuronal calcium channel subtypes. J Biol Chem. 2000 Nov 10;275(45):35335-44. doi: 10.1074/jbc.M002252200.
Ref 9 A new omega-conotoxin that targets N-type voltage-sensitive calcium channels with unusual specificity. Biochemistry. 2001 Dec 4;40(48):14567-75. doi: 10.1021/bi002871r.
Ref 10 Three-dimensional structure of omega-conotoxin GVIA determined by 1H NMR. Biochem Biophys Res Commun. 1993 May 14;192(3):1238-44. doi: 10.1006/bbrc.1993.1549.
Ref 11 Solution structure of omega-conotoxin GVIA using 2-D NMR spectroscopy and relaxation matrix analysis. Biochemistry. 1993 Jul 27;32(29):7396-405. doi: 10.1021/bi00080a009.
Ref 12 Three-dimensional structure in solution of the calcium channel blocker omega-conotoxin. J Mol Biol. 1993 Nov 20;234(2):405-20. doi: 10.1006/jmbi.1993.1595.
Ref 13 Solution structure of the calcium channel antagonist omega-conotoxin GVIA. Protein Sci. 1993 Oct;2(10):1591-603. doi: 10.1002/pro.5560021005.
Ref 14 Refined solution structure of omega-conotoxin GVIA: implications for calcium channel binding. J Pept Res. 1999 Mar;53(3):343-51. doi: 10.1034/j.1399-3011.1999.00040.x.
Ref 15 Structure-activity relationships of omega-conotoxins at N-type voltage-sensitive calcium channels. J Mol Recognit. 2000 Mar-Apr;13(2):55-70. doi: 10.1002/(SICI)1099-1352(200003/04)13:2<55::AID-JMR488>3.0.CO;2-O.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.