General Information of This Peptide
Peptide ID
BTDP003871
Peptide Name
Alpha-cobratoxin
Symonym
Alpha-elapitoxin-Nk2a; Long neurotoxin 1; Siamensis 3
Species
Naja kaouthia (Monocled cobra) (Naja siamensis)
Uniprot Name
3L21_NAJKA
Alphafold ID
P01391
3D Structure
Download
2D Sequence
3D Structure
Source
RSCB PDB: 1CTX
Sequence
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTD
NCNPFPTRKRP
   Click to Show/Hide
Sequence Length
71
Mass (Da)
7831
Sequence Removed Signal Peptide
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTD
NCNPFPTRKRP
   Click to Show/Hide
Disulfide Bond
3-20;3;14-41;20;26-30;45-56;57-62
PDB ID
1CTX , 1LXG , 1LXH , 1YI5 , 4AEA , 6ZFM , 7PC0 , 7ULG
        Click to Show/Hide the Complete Species Lineage
Kingdom: Metazoa
Phylum: Chordata
Class: Lepidosauria
Order: Squamata
Family: Elapidae
Genus: Naja
Species: Naja kaouthia
Full List of Activity Data of This Peptide Toxin
                        Target Name Activity Data Type Activity Data Concentration Note Reference
 Target Info    nAChR muscle-type alpha-1-beta-1-gamma-delta Dissociation constant
0.2 - 4.5 nM
.
Monomer
[1- 19]
 Target Info    nAChR alpha-7 Dissociation constant
13 - 105 nM
.
Monomer
[1- 19]
 Target Info    nAChR alpha-3/beta-2 Effect . .
Monomer
[1- 19]
 Target Info    homopentameric alpha-1 glycine receptor (GLRA1) Inhibition rate .
40 μM
Monomer
[1- 19]
 Target Info    nAChR muscular alpha-7 IC50
9.7 nM
.
Homodimer
[1- 19]
 Target Info    nAChR alpha-1-beta-3-gamma-2 IC50
236 nM
.
Heteropentamer
[1- 19]
 Target Info    nAChR alpha-1-beta-2-gamma-2 IC50
469 nM
.
Heteropentamer
[1- 19]
 Target Info    nAChR alpha-2-beta-2-gamma-2 IC50
485 nM
.
Heteropentamer
[1- 19]
 Target Info    nAChR alpha-5-beta-3-gamma-2 IC50
635 nM
.
Heteropentamer
[1- 19]
 Target Info    nAChR alpha-2-beta-3-gamma-2 IC50
1.099 μM
.
Heteropentamer
[1- 19]
 Target Info    neuronal nAChR alpha-7 IC50
1.37 μM
.
Homodimer
[1- 19]
References
Ref 1 Naturally occurring disulfide-bound dimers of three-fingered toxins: a paradigm for biological activity diversification. J Biol Chem. 2008 May 23;283(21):14571-80. doi: 10.1074/jbc.M802085200. Epub 2008 Apr 1.
Ref 2 Fluorescein isothiocyanate-labeled alpha-cobratoxin. Biochemical characterization and interaction with acetylcholine receptor from Electrophorus electricus. J Biol Chem. 1980 Aug 10;255(15):7326-32.
Ref 3 The sites of neurotoxicity in alpha-cobratoxin. J Biol Chem. 1983 Jul 25;258(14):8714-22.
Ref 4 alpha-Cobratoxin blocks the nicotinic acetylcholine receptor in rat hippocampal neurons. Eur J Pharmacol. 1990 Dec 4;191(3):505-6. doi: 10.1016/0014-2999(90)94190-9.
Ref 5 alpha-Bungarotoxin, kappa-bungarotoxin, alpha-cobratoxin and erabutoxin-b do not affect [3H]acetylcholine release from the rat isolated left hemidiaphragm. Naunyn Schmiedebergs Arch Pharmacol. 1995 Dec;352(6):646-52. doi: 10.1007/BF00171324.
Ref 6 Only snake curaremimetic toxins with a fifth disulfide bond have high affinity for the neuronal alpha7 nicotinic receptor. J Biol Chem. 1997 Sep 26;272(39):24279-86. doi: 10.1074/jbc.272.39.24279.
Ref 7 Effects of alpha-erabutoxin, alpha-bungarotoxin, alpha-cobratoxin and fasciculin on the nicotine-evoked release of dopamine in the rat striatum in vivo. Neurochem Int. 1998 Oct;33(4):307-12. doi: 10.1016/s0197-0186(98)00033-3.
Ref 8 Variability among the sites by which curaremimetic toxins bind to torpedo acetylcholine receptor, as revealed by identification of the functional residues of alpha-cobratoxin. J Biol Chem. 1999 Dec 3;274(49):34851-8. doi: 10.1074/jbc.274.49.34851.
Ref 9 Molecular determinants by which a long chain toxin from snake venom interacts with the neuronal alpha 7-nicotinic acetylcholine receptor. J Biol Chem. 2000 Sep 22;275(38):29594-601. doi: 10.1074/jbc.M909746199.
Ref 10 Neurotoxins from snake venoms and -conotoxin ImI inhibit functionally active ionotropic -aminobutyric acid (GABA) receptors. J Biol Chem. 2015 Sep 11;290(37):22747-58. doi: 10.1074/jbc.M115.648824. Epub 2015 Jul 28.
Ref 11 Species specificity of rat and human 7 nicotinic acetylcholine receptors towards different classes of peptide and protein antagonists. Neuropharmacology. 2018 Sep 1;139:226-237. doi: 10.1016/j.neuropharm.2018.07.019. Epub 2018 Jul 17.
Ref 12 Experimentally based model of a complex between a snake toxin and the alpha 7 nicotinic receptor. Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):3216-21. doi: 10.1073/pnas.042699899. Epub 2002 Feb 26.
Ref 13 Three-dimensional structure of the "long" neurotoxin from cobra venom. Proc Natl Acad Sci U S A. 1980 May;77(5):2400-4. doi: 10.1073/pnas.77.5.2400.
Ref 14 The refined crystal structure of alpha-cobratoxin from Naja naja siamensis at 2.4-A resolution. J Biol Chem. 1991 Nov 15;266(32):21530-6. doi: 10.2210/pdb2ctx/pdb.
Ref 15 Rapid determination and NMR assignments of antiparallel sheets and helices of a scorpion and a cobra toxin. Int J Pept Protein Res. 1990 Sep;36(3):227-30. doi: 10.1111/j.1399-3011.1990.tb00971.x.
Ref 16 Alpha-cobratoxin: proton NMR assignments and solution structure. Biochemistry. 1992 May 26;31(20):4867-75. doi: 10.1021/bi00135a018.
Ref 17 NMR-based binding screen and structural analysis of the complex formed between alpha-cobratoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica. J Biol Chem. 2002 Oct 4;277(40):37439-45. doi: 10.1074/jbc.M205483200. Epub 2002 Jul 19.
Ref 18 Crystal structure of a Cbtx-AChBP complex reveals essential interactions between snake alpha-neurotoxins and nicotinic receptors. EMBO J. 2005 Apr 20;24(8):1512-22. doi: 10.1038/sj.emboj.7600620. Epub 2005 Mar 24.
Ref 19 Dimeric -cobratoxin X-ray structure: localization of intermolecular disulfides and possible mode of binding to nicotinic acetylcholine receptors. J Biol Chem. 2012 Feb 24;287(9):6725-34. doi: 10.1074/jbc.M111.322313. Epub 2012 Jan 5.
Data Quality & Feedback

Help us maintain data quality by reporting any errors or inaccuracies you may find.

samedaypayday.com visits since 2024

If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.