Peptide Information
General Information of This Peptide
| Peptide ID |
BTDP003739
|
|||||
|---|---|---|---|---|---|---|
| Peptide Name |
[Thr6]-bradykinyl-Val,Asp
|
|||||
| Symonym |
Bradykinin-related peptide RD-11
|
|||||
| Species |
Agalychnis callidryas (Red-eyed tree frog) (Phyllomedusa callidryas)
|
|||||
| Uniprot Name | ||||||
| Alphafold ID | ||||||
| 3D Structure |
|
|||||
| Sequence |
MSFLKKSLFLVLFLGLVSFSICEEEKRETEEEENEDEMDKESEEKRESPERPPGFTPFRV
D Click to Show/Hide
|
|||||
| Sequence Length |
61
|
|||||
| Mass (Da) |
7245
|
|||||
| Signal Sequence |
MSFLKKSLFLVLFLGLVSFSIC
Click to Show/Hide
|
|||||
| Sequence Removed Signal Peptide |
EEEKRETEEEENEDEMDKESEEKRESPERPPGFTPFRVD
Click to Show/Hide
|
|||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Full List of Activity Data of This Peptide Toxin
| Target Name | Activity Data Type | Activity Data | Concentration | Note | Reference |
|---|---|---|---|---|---|
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
1.1 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
1.2 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
1.5 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
3.5 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
3.9 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
4.6 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
10.8 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
16.8 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
56.7 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
60.3 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
205 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
223 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
356 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
588 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
645 nM
|
. | . | [1] |
| Target Info bradykinin receptor B1 (BDKRB1) and B2 (BDKRB9) | Effective concentration 50 |
895 nM
|
. | . | [1] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
