Peptide Information
General Information of This Peptide
| Peptide ID |
BTDP003462
|
|||||
|---|---|---|---|---|---|---|
| Peptide Name |
Alpha-conotoxin Vc1.2
|
|||||
| Species |
Conus victoriae (Queen Victoria cone)
|
|||||
| Uniprot Name | ||||||
| Alphafold ID | ||||||
| 3D Structure |
|
|||||
| Sequence |
MGMRMMFTVFLLVVLATTVVFFTSDRASDGRKAAASDLITLTIKGCCSNPACMVNNPQIC
GRRR Click to Show/Hide
|
|||||
| Sequence Length |
64
|
|||||
| Mass (Da) |
6988
|
|||||
| Signal Sequence |
MGMRMMFTVFLLVVLATTVVFFTS
Click to Show/Hide
|
|||||
| Sequence Removed Signal Peptide |
DRASDGRKAAASDLITLTIKGCCSNPACMVNNPQICGRRR
Click to Show/Hide
|
|||||
| Disulfide Bond |
46-52;47-60
|
|||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Full List of Activity Data of This Peptide Toxin
| Target Name | Activity Data Type | Activity Data | Concentration | Note | Reference |
|---|---|---|---|---|---|
| Target Info GABBR1 and/or GABBR2 | Inhibition rate |
30 %
|
100 nM
|
Inhibit high-voltage activated (HVA) calcium channels currents mediated by GABA(B) receptors (GABBR1 and GABBR2)
|
[1] |
| Target Info nAChR alpha-3-beta-2 | IC50 |
75 nM
|
. |
Inhibit high-voltage activated (HVA) calcium channels currents mediated by GABA(B) receptors (GABBR1 and GABBR2)
|
[1] |
| Target Info nAChR alpha-7 | IC50 |
637 nM
|
. |
Inhibit high-voltage activated (HVA) calcium channels currents mediated by GABA(B) receptors (GABBR1 and GABBR2)
|
[1] |
| Target Info nAChR alpha-9-alpha-10 | IC50 |
1 μM
|
. |
Inhibit high-voltage activated (HVA) calcium channels currents mediated by GABA(B) receptors (GABBR1 and GABBR2)
|
[1] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.