Target Information
General Information of This Target
| Target ID |
BTDT00132
|
|||||
|---|---|---|---|---|---|---|
| Target Name |
Potassium channel toxin alpha-KTx 6.1
|
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Uniprot ID | ||||||
| 3D Structure | ||||||
| Synonym |
PiTX-K-gamma; Potassium channel-blocking toxin 1
|
|||||
| Sequence |
LVKCRGTSDCGRPCQQQTGCPNSKCINRMCKCYGC
Click to Show/Hide
|
|||||
| Family |
the short scorpion toxin superfamily.Potassium channel inhibitor family
|
|||||
| Function |
Potently and reversibly inhibits the insect voltage-gated Shaker (Sh) potassium channel (isoform alpha (B)), the mammalian voltage-gated potassium channels Kv1.2/KCNA2 (IC(50)=0.44 nM), and the calcium-activated potassium channel KCa2.3/KCNN3 (Kd=330 nM). Its effect on Kv1.3/KCNA3 is controversial, since this channel is voltage- independently inhibited in but is not affected in . Furthermore, this toxin competes with apamin (a small conductance calcium-activated potassium channel inhibitor) for binding to rat brain synaptosomes.
Click to Show/Hide
|
|||||
| Taxonomy ID | ||||||
| Click to Show/Hide the Complete Species Lineage | ||||||
Toxin Information Related to This Target
| Toxin Name | Activity Data Type | Activity Data | Reference |
|---|---|---|---|
| Toxin Info Toxin II.10.4 (7TP,D9Q) | Dissociation constant |
88 nM
|
[1] |
References
Data Quality & Feedback
Help us maintain data quality by reporting any errors or inaccuracies you may find.
visits since 2024
If you find any error in data or bug in web service, please kindly report it to biodb_contact@163.com et al.
